KEGG   Escherichia coli ATCC 8739: EcolC_4099Help
Entry
EcolC_4099        CDS       T00697                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
ecl00010  Glycolysis / Gluconeogenesis
ecl00051  Fructose and mannose metabolism
ecl00562  Inositol phosphate metabolism
ecl01100  Metabolic pathways
ecl01110  Biosynthesis of secondary metabolites
ecl01120  Microbial metabolism in diverse environments
ecl01130  Biosynthesis of antibiotics
ecl01200  Carbon metabolism
ecl01230  Biosynthesis of amino acids
Module
ecl_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ecl_M00002  Glycolysis, core module involving three-carbon compounds
ecl_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcolC_4099
   00051 Fructose and mannose metabolism
    EcolC_4099
   00562 Inositol phosphate metabolism
    EcolC_4099
Enzymes [BR:ecl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     EcolC_4099
Exosome [BR:ecl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   EcolC_4099
  Exosomal proteins of bladder cancer cells
   EcolC_4099
  Exosomal proteins of melanoma cells
   EcolC_4099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACA79697
JGI: EcolC4099
UniProt: B1IVG0
Structure
PDB: 

Jmol
Position
4523793..4524560
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVHELVSNLRKELAGVAGCAVAIAPPEMYIDMAKREAEGSHIM
LGAQNVDLNLSGAFTGETSAAMLKDIGAQYIIIGHSERRTYHKESDELIAKKFAVLKEQG
LTPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKVDANIAEQVIIQYGGSVNASNAAELFAQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggttcac
gagctggtttctaacctgcgtaaagagctggcaggtgttgctggctgtgcggttgcaatc
gcaccaccggaaatgtacatcgatatggcgaagcgcgaagctgaaggcagccacatcatg
ctgggtgcgcaaaacgtggacctgaacctgtccggcgcattcaccggtgaaacttctgcc
gctatgctgaaagacatcggcgctcagtacatcatcatcggccactctgaacgtcgtact
taccacaaagagtctgacgaactgatcgcgaaaaaattcgcggtgctgaaagagcagggc
ctgactccggttctgtgcatcggtgaaaccgaagctgaaaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcggtactgaaaactcagggtgctgcggcattcgaa
ggtgcggttatcgcttacgaacctgtatgggcaatcggtactggcaaatctgcaactccg
gctcaggcacaggctgttcacaaattcatccgtgaccacatcgctaaagttgacgctaac
atcgctgaacaagtgatcattcagtacggcggctctgtaaacgcgtctaacgctgcagaa
ctgtttgctcagccagatatcgacggcgcgctggttggcggtgcttctctgaaagctgac
gctttcgcagtgatcgttaaagctgcagaagcggctaaacaggcttaa

DBGET integrated database retrieval system