KEGG   Escherichia coli ATCC 8739: EcolC_4164Help
Entry
EcolC_4164        CDS       T00697                                 

Definition
(GenBank) fatty oxidation complex, alpha subunit FadB
  KO
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ecl  Escherichia coli ATCC 8739
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EcolC_4164
   01212 Fatty acid metabolism
    EcolC_4164
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EcolC_4164
   00650 Butanoate metabolism
    EcolC_4164
  Lipid metabolism
   00071 Fatty acid degradation
    EcolC_4164
   01040 Biosynthesis of unsaturated fatty acids
    EcolC_4164
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EcolC_4164
   00310 Lysine degradation
    EcolC_4164
   00380 Tryptophan metabolism
    EcolC_4164
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EcolC_4164
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EcolC_4164
   00281 Geraniol degradation
    EcolC_4164
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EcolC_4164
   00930 Caprolactam degradation
    EcolC_4164
Enzymes [BR:ecl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EcolC_4164
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EcolC_4164
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EcolC_4164
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     EcolC_4164
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4600885..4603074
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLVEGAKAVLRQAINGDLDWKAKRQPKLEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEQKVRP
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVEDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaacggctatgcgctgggcggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcgctggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactggttgaaggcgcaaaggcggtt
ttacgccaggccattaacggcgacctcgactggaaagcaaaacgtcagccgaagctggaa
ccactaaaactgagcaagattgaagccaccatgagcttcaccatcgctaaagggatggtc
gcacaaacagcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagct
gcggcccgttttggtcgtgaagaagccttaaacctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagcccgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccgaaacaggccgcggtgctgggt
gcaggcattatgggcggcggcatcgcttaccagtctgcgtggaaaggcgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaagatcgatggtctgaaactggctggcgtgatctccaca
atccacccaacgctcgactacgccgggtttgaccgcgtggatgttgtggtagaagcggtt
gtcgaaaacccgaaagtgaaaaaagccgtactggcagaaaccgaacaaaaagtacgcccg
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgcccggaaaacttctgcggaatgcacttttttaacccggtacaccggatgccgttg
gtagaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagttgtcgcctgg
gcgagcaagatgggcaagacgccgattgtggttaacgactgccccggcttctttgttaac
cgcgtgctgttcccgtatttcgccggtttcagccagctgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggtccggcatatctg
ctggacgttgtgggcattgataccgcgcatcacgctcaggctgtcatggcagcaggcttc
ccgcagcggatgcagaaagattaccgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgccgttgaagacctgctggcagaagtgagccagccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaggaaggcattatcgccactccggcagaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggtagc
gcaaaataccttgatatggcacagcaatatcagcacctcggcccgctgtatgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcccccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system