KEGG   Enterobacter cloacae GGT036: EC036_29830Help
Entry
EC036_29830       CDS       T03429                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
eclg  Enterobacter cloacae GGT036
Pathway
eclg00052  Galactose metabolism
eclg00500  Starch and sucrose metabolism
eclg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EC036_29830
   00500 Starch and sucrose metabolism
    EC036_29830
Enzymes [BR:eclg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     EC036_29830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIV30630
Position
complement(3227481..3228914)
Genome map
AA seq 477 aa AA seqDB search
MTYSITKAEQELQSRREELNLRWYPRYHLAARAGWMNDPNGLVWFDGWYHAFYQHHPYST
QWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHGD
PDDEANLYQVQCLATSRDGIHFVRQGMIVDTPPGLHHFRDPKVWREGESWYMVVGARDGE
TGQVRVYRSADLREWQNMGVLAVAEKEMGYMWECPDFFMLNGKRVLMFSPQGMAAEGFKN
RNLFQSGYLLGEWQPGQPFVREGEFVEMDRGHDFYAPQSFLTPDGRRIVIGWLDMWESPL
PEQEDGWAGMLSLPRELTLGADHRLQMRPAREVEGLRGAWFPWPVSTLNNQQMTLMERCD
AMEVILQWDCANSSAEQYGMSLGEGLRVYVDAQMQRLVLERNYPQYGLCGTRSVALNLDN
TLNLRLFFDSSSVEVFVNEGDACLSSRIYPEAGRREINLFAWGGSALLFEAGAWQLE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgacgtattcaattactaaagcagagcaggaacttcagtccagacgcgaagagctcaat
ctgcgctggtatccacgttaccacctcgctgcgcgcgctggctggatgaacgacccaaat
ggcctggtctggtttgacggttggtatcacgctttttaccagcatcatccgtactcgacc
cagtgggggcctatgcactggggccatgcgcgtagcaaggatttagttcactgggaacat
ctccccgttgcgctggcgccagaagggcctgaagacaaggatggctgtttttccggatcg
gcggtggtggatggcgatacgctggcgctgatttacaccggacataaattccacggcgat
cctgatgacgaggcgaatctctaccaggtgcaatgtctggcgaccagccgtgacggcatt
cattttgtccggcagggaatgatcgttgataccccgccaggcctgcatcacttccgcgac
ccgaaagtgtggcgtgaaggggagagctggtacatggttgtcggtgcgcgggacggtgag
acgggccaggtgcgtgtatatcgttctgccgatctgcgcgagtggcagaatatgggcgtg
ctggcggtggctgaaaaagagatgggctacatgtgggaatgcccggactttttcatgctc
aatggcaaacgcgtgctgatgttttcgcctcaggggatggccgctgaaggattcaaaaac
cgtaatcttttccagagcggctatctgttgggcgagtggcagcccgggcaaccttttgtg
cgggaaggtgagtttgtggagatggatcgcgggcatgatttctatgcgccacaaagtttc
ctcacgcctgatggtcgtcgcatcgttatcggctggctggacatgtgggaatccccgctg
ccggaacaggaggacggctgggctggcatgctctctttacctcgcgaactgacgcttggc
gcggatcaccgtctgcaaatgcggccagccagagaggtcgaaggcctgcggggagcgtgg
ttcccctggccggttagcacgcttaacaatcagcaaatgactctgatggaacgctgcgac
gcgatggaggttattctgcagtgggattgtgccaatagcagtgccgagcagtacggcatg
agtctgggagaggggctgcgcgtctacgtggatgctcaaatgcagcgtctggttcttgag
cgaaactatccgcagtatggcttgtgcgggacacgaagcgtcgcgctgaacctggataat
acgcttaatctgcgtctgttcttcgacagttcttccgtggaagtttttgtcaatgaaggc
gacgcgtgtttaagcagccgaatttatcctgaggcagggcgaagggaaataaatttattc
gcctggggtggctcagcgttattattcgaagccggagcctggcagctggagtga

DBGET integrated database retrieval system