KEGG   Enterobacter cloacae ECNIH5: ECNIH5_10955Help
Entry
ECNIH5_10955      CDS       T03706                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecli  Enterobacter cloacae ECNIH5
Pathway
ecli00052  Galactose metabolism
ecli00500  Starch and sucrose metabolism
ecli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecli00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ECNIH5_10955
   00500 Starch and sucrose metabolism
    ECNIH5_10955
Enzymes [BR:ecli01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ECNIH5_10955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIX59256
Position
2304999..2306405
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAVLQAVMQGQPRALADSHYPQWHPAPVTGLMNDPNGFIWFAERYHLFYQWNP
LGCDHRYKCWGHWSSADLVHWQHEPMALMPDEEYDRNGCYSGSAVDNNGVLTLCYTGNVK
FDDGGRTAWQCLAVQNDDGTFAKLGPVLPLPDGYTGHVRDPKVWRHDGQWYMVLGAQDQH
KRGKVLLFTSADLHTWASCGEIAGHGVNGLTDAGYMWECPDLFALDGTHVLICCPQGLAR
EPHRYLNTYPAVWMSGAFDYQTPAFAHDELHELDAGFEFYAPQTTVAEDGRRILIGWMGV
PDGEEMLQPTRGHGWIHQMTCPRELRYRDGKLWQTPVRELETLREDEHHWQGRASDAPVL
EGTRLEFELSASCVKVDFAGALRLIVDDAGIRLERASLETGETLTRYWQGSVHHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPAQVRFEGASDITLRYWSLRSCMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaccttaccttcccgctggcctgccgtgttgcaggccgttatgcaaggccagccgcgt
gcgctggcggacagccactatccgcagtggcatcccgcaccggtgacagggctgatgaac
gatccgaacggctttatctggtttgccgaacgttaccatctgttttatcagtggaacccg
ctgggctgcgatcatcgctacaagtgctggggacactggagctcagcagatctggtgcac
tggcagcacgagccaatggcgctgatgcctgacgaagagtatgaccgcaatggctgttac
tccggcagcgccgtggataacaacggcgtgctgaccctgtgctataccggcaacgttaag
tttgacgatggcggccgcaccgcctggcagtgtctggcggtgcaaaatgacgacggcacg
tttgccaaactgggaccggtgttgcccctgccggacgggtataccgggcacgtccgcgac
ccgaaagtgtggcgccatgacgggcagtggtacatggtgctcggggcgcaggatcagcat
aagcgcggcaaggtgctgctgtttacgtcagccgatttgcacacctgggcgtcctgcggc
gaaatcgctggtcacggcgtcaacggactcacggacgcgggctatatgtgggagtgcccg
gatctgtttgcgcttgatggcacacacgtcttgatctgctgcccacaggggctggcgcgc
gaaccgcatcgctatctcaacacctatccggccgtctggatgagtggggcatttgattat
caaacgcctgcatttgcgcacgacgaattgcatgagcttgatgccggtttcgaattttac
gcgccgcaaaccacggtggcagaagatggccgccgcatcctcatcggctggatgggcgtg
ccggacggcgaagagatgctccagcctacacgggggcacggctggatccaccagatgacc
tgtccgcgcgagctgcgctaccgcgacggtaagctctggcaaacgccggtccgtgagctg
gaaacgctgcgcgaggatgaacatcactggcagggacgcgccagcgatgccccggtgctg
gagggaacccgtcttgagttcgaactgagcgcatcgtgcgtaaaagtggattttgccggc
gcgttgcggctgattgtggatgatgcggggatccgtctggaacgcgccagcctggaaacc
ggagagacgttgacccgctactggcagggctctgttcatcatttacgcgtgctgtgtgac
cgttccagcgtcgaaattttcatcaatcacggtgaaggcgtcatgagcagccgctatttt
cctgaccatccggcccaggttcgcttcgaaggtgcgtccgacatcacattacgctactgg
tcgctgcgcagctgcatgatagaatag

DBGET integrated database retrieval system