KEGG   Enterobacter cloacae ECNIH4: ECNIH4_04585Help
Entry
ECNIH4_04585      CDS       T03486                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ecln  Enterobacter cloacae ECNIH4
Pathway
ecln00071  Fatty acid degradation
ecln00072  Synthesis and degradation of ketone bodies
ecln00280  Valine, leucine and isoleucine degradation
ecln00310  Lysine degradation
ecln00362  Benzoate degradation
ecln00380  Tryptophan metabolism
ecln00620  Pyruvate metabolism
ecln00630  Glyoxylate and dicarboxylate metabolism
ecln00640  Propanoate metabolism
ecln00650  Butanoate metabolism
ecln00900  Terpenoid backbone biosynthesis
ecln01100  Metabolic pathways
ecln01110  Biosynthesis of secondary metabolites
ecln01120  Microbial metabolism in diverse environments
ecln01130  Biosynthesis of antibiotics
ecln01200  Carbon metabolism
ecln01212  Fatty acid metabolism
ecln02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecln00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECNIH4_04585
   00630 Glyoxylate and dicarboxylate metabolism
    ECNIH4_04585
   00640 Propanoate metabolism
    ECNIH4_04585
   00650 Butanoate metabolism
    ECNIH4_04585
  Lipid metabolism
   00071 Fatty acid degradation
    ECNIH4_04585
   00072 Synthesis and degradation of ketone bodies
    ECNIH4_04585
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ECNIH4_04585
   00310 Lysine degradation
    ECNIH4_04585
   00380 Tryptophan metabolism
    ECNIH4_04585
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ECNIH4_04585
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ECNIH4_04585
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ECNIH4_04585
Enzymes [BR:ecln01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ECNIH4_04585
Exosome [BR:ecln04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ECNIH4_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIX53561
UniProt: A0A2J0PJS7
Position
944306..945484
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALARHSAVDLGSVVVKALVERSGVAAHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLLDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTQRQNGEVVVVDTDEQPRTDASAEGLARLNPAFETQG
SVTAGNASSINDGAAAVMMMSESKALELDLPVLARIKAFASVGVDPALMGIAPVYATRRC
LDRAGWQLSDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMKKRNARKGIATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgtcatagtgggtgcgttgcgtacagctatcggctgttttcagggagcg
ctcgcgcgtcactcggcggttgacctgggcagcgtggtggtcaaagcgctggtggaacgt
agcggggtcgccgcacacgaaattgatgaggtgatcctggggcaggttctcactgccgga
gccgggcaaaaccctgcgcgccaggcggccctgaaaggcggtctgcccaacaccgtatcc
gccatcaccatcaacgacgtctgtggttcaggactcaaagcgcttcatctcgctacgcaa
gccattcaatgcggtgaagcggatgtggttattgctggcggacaagagaatatgagccgt
gcgccgcacgttctcaccgacagtcgtaccggtgcgcagttaggtaacagtcagttgctc
gacagcctggtgcatgacgggctgtgggatgcgttcaatgactatcatatgggcgtgacg
gcggaaaacctggcgcgcgagtacggtatcagccgtgaattgcaggatgcttacgcgctc
agttcccagcaaaaggcgcgtgctgcgattgattctggtcgttttcgcgacgagattgtc
ccggtcagcacgcagcgtcagaacggcgaggtggttgtcgtggatactgacgaacagccg
cgcactgacgccagtgctgaaggcctggcaagactcaatcctgcgtttgaaacccagggc
tcggtcacggcgggcaatgcctcttccattaacgacggcgccgcagccgttatgatgatg
agtgaaagtaaagccctggagctggatctccctgtcctggcccgcatcaaggcttttgcc
agcgtgggtgttgatcctgcactgatggggatcgcacccgtctacgctacccgtcgctgt
ctggatcgcgcagggtggcaactctccgatgtggatctgattgaagtgaacgaagcgttt
gccgcgcaggcgatctcggtcggcaaaatgctggagtgggatccgctgcgggtcaacgta
aacggtggagccattgcgctgggtcaccctatcggggcgtccggttgccggatactggtt
tcactggtccacgaaatgaaaaaacgcaatgcccgcaaagggatagcaacgctctgtata
ggcggcgggcaaggggtggcgctggccatcgaacgctaa

DBGET integrated database retrieval system