KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_00550Help
Entry
ENC_00550         CDS       T02615                                 

Definition
Alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eclo00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:eclo00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
47884..50007
Genome map
AA seq 707 aa AA seqDB search
MQDSIFRLESNTVDVVVKTHPFAEILYWGPHLQHFSPQDVLSIARPVANGRLDVDSPVTL
MAELGHGLFGSPGIEGHRQGLDGSPVFTTTGVQQQGQTLTVTAEDKQAGLRLTSELTLDA
SGVLVVRHGLTNLKMQAWQVDRFAVTLPVAERAQEVMAFHGRWIREFQPHRVMLEHDSFV
IENRRGKTSHEHFPALISGTPSFSEMHGNVWGIHLGWSGNHRLRAEAKTDGRRYMQAEAL
YLPGEMAIEEGETLWTPRLYASHSPHGLNGMSQQFHRYLRDNVIRFPEDKPRPVHLNTWE
GIYFNHDPDYIMRMADEAAALGVERFIIDDGWFKGRNDDHAALGDWYLDEKKYPNGLKPV
IDHVKQLGMEFGIWVEPEMINPDSDLYRAHPDWVLALPGYAQATGRHQLVLNLNIPQAFE
YLVERMSWLLGEHAVDYVKWDMNRELVQPGHKGKAAADAQTRQFYRLLDVLGERFPHIEF
ESCSSGGGRIDYEVLTRCHRFWASDNNDALERNTIQRGMSYFFPPEVMGAHIGHHKCHAT
FRQHSIQFRGLTALFGHMGLELDPLTVDAQEREGYRHYAALHKRWREVIHHGTQWRVDMP
DATTLAQGIVSEDKTQGLFLVSQLAMPDYTLMMPLRMPGLDASALYRITLLDHPNIQITG
EGGHTMRKLPAWMNAPQTVSGEWLMQAGIALPILDPETAILIGVERV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgcaagattccatttttcgacttgaaagcaatacggttgacgtggtggtaaaaacccac
ccgttcgccgaaattctctactgggggccacaccttcagcacttttcgccgcaggatgtg
ctgagtattgcgcgcccggttgctaatggcaggctggacgtcgactcccccgtcacgctg
atggcagagctggggcatgggctgtttggttcgcccggcatcgaggggcatcgccagggg
ctggacggatcgcctgtcttcaccacaacaggcgtacaacagcaggggcaaaccctgacg
gtaacggcagaagataaacaggcgggcctgcgcctgaccagtgaattaacgctggatgcc
agcggcgtactggtggtgcgtcatgggttaaccaacctgaaaatgcaggcgtggcaggtg
gatcgatttgccgtgacgctgccggtggccgaacgagcgcaggaggtgatggccttccac
ggacgttggatcagggagtttcagccgcaccgcgtgatgcttgaacatgacagctttgtg
attgaaaaccgtcggggtaaaacctcccatgaacatttcccggcgctgatttcaggtacg
ccgtcattcagtgaaatgcacggcaacgtctggggtatacatctgggctggagtggtaac
caccgcctgcgcgcagaggcgaaaaccgatggccgccgctatatgcaggccgaagcgctc
tacctgccgggtgaaatggcgattgaagagggggaaacgctctggacgccgcgcctgtat
gccagccactccccgcacgggctgaacggcatgagccagcagttccaccgctacctgcgc
gacaatgttatccgcttcccggaagataaaccgcgcccggtgcacctcaacacctgggag
gggatctacttcaaccacgacccggactacatcatgcgcatggccgacgaggccgcagcg
ctgggtgtcgagcgctttatcattgacgacggctggttcaaaggccgcaacgacgaccac
gccgcgctgggcgactggtatctggacgagaaaaaatacccgaacggcctaaagccggta
atcgatcacgttaaacagctcggcatggagtttggtatctgggttgagccggagatgatt
aacccggattccgatctgtatcgcgcgcaccctgactgggtgctggcgctgccgggctac
gcccaggcgaccgggcgacaccagctggtcctcaatctcaatattccgcaggcctttgaa
tatctggtcgaacgcatgagctggctgctgggcgaacacgcggtcgactacgtgaaatgg
gatatgaaccgcgagctggtgcagccagggcacaagggcaaagccgccgccgacgcccag
acgcgccagttttatcgcctgctggacgtgctgggcgagcgcttcccgcacattgagttt
gaatcctgctcctccggcggcgggcgaatcgattatgaagtgctgacccgctgccaccgc
ttctgggcgtccgacaacaacgacgcgctggagcgcaacactatccagcgcggcatgagc
tacttcttcccgccggaggtgatgggcgcgcatatcggtcatcataaatgtcacgccacc
ttccgccagcacagcattcagttccgcgggctaacagcgctgtttggtcacatggggctg
gagctggatccgctcaccgtcgatgcgcaggagcgtgaaggctatcgccattacgccgcg
ctgcacaagcggtggcgagaggtcattcatcacggcacccagtggcgcgtggatatgccg
gacgccaccaccctggcgcagggtatagtgagcgaagataagacgcaggggctgtttttg
gtcagccagctcgcgatgccggattacaccctgatgatgccgctgcgcatgccggggtta
gacgccagcgcgctgtaccgcatcacgctgctcgatcacccgaacatccagattacgggc
gagggcgggcacaccatgcgtaagctgccggcgtggatgaacgcgccgcaaacggtaagc
ggtgagtggctgatgcaggcgggtattgcgctgccgattctggatccggaaaccgccatt
ctgattggtgtggaacgcgtgtaa

DBGET integrated database retrieval system