KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_04380Help
Entry
ENC_04380         CDS       T02615                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ENC_04380
Enzymes [BR:eclo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ENC_04380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
461046..461975
Genome map
AA seq 309 aa AA seqDB search
MKTAGNLVVLGSINADHILNLETFPTPGETVTGNQYQVAFGGKGANQAVAAGRSGANIAF
IACTGDDDTGERVRKQLASDNIDIAPVSVVAGESTGVALIFVNAEGENVIGIHAGANAAL
TTERVEAQRGIIAGAEALLMQLESPVESVLAAAKIAHENHTSVVLNPAPARVLSDELLAL
VDIITPNETEAEKLTGIRVENDDDAARAALALHEKGIGTVIITLGSRGVWASVNGEGRRV
PGFKVKAIDTIAAGDTFNGALVTALLEGKAMDDAIRFAHAAAAIAVTRKGAQPSVPWRKE
IDEFLSQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgcaggcaacctcgtcgtccttggcagtatcaatgccgatcacattcttaac
cttgaaacgttccccactccgggcgaaaccgtcactggcaatcagtatcaggtggcgttc
ggcggtaagggcgcaaaccaggcggttgccgccggacgcagcggggcgaatatcgcgttt
atcgcctgtacgggtgatgacgataccggcgagcgcgtacgcaaacagctggcaagcgac
aacatcgacattgcacccgtcagcgtggttgcaggggaatctaccggcgtggcgctgatt
ttcgtcaatgcggaaggtgagaatgtcatcggtattcatgcaggggctaatgccgcgtta
acgactgaacgcgtcgaagcgcagcgtggaatcatcgccggagcggaagccctgctgatg
cagctggagtcaccggttgaaagcgtgctggccgccgcgaaaattgcgcatgaaaatcat
acgtctgtcgtacttaaccctgcgcctgcccgtgtattatcagatgagctgctggcgctg
gtggatatcatcaccccgaacgaaaccgaagcggaaaagctgacgggtatccgtgtcgaa
aatgatgacgatgccgcgcgtgccgcgcttgcactgcatgaaaaaggcatcggcaccgta
ataatcaccctcggcagccgtggggtgtgggctagcgtcaatggcgaaggccgtcgcgta
ccgggctttaaggtcaaagccattgataccatcgccgcaggagacaccttcaacggtgca
ctggtaacggcgctgctggaaggaaaagcaatggatgacgcgatccgcttcgcgcatgcc
gccgctgcgattgcggtgacgcgtaaaggcgctcagccttctgttccatggcgtaaagag
attgatgaattcttaagtcagcaggggtaa

DBGET integrated database retrieval system