KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_04450Help
Entry
ENC_04450         CDS       T02615                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:eclo01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eclo00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
467584..468903
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELQKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQNGAAKMWD
LLHGGSKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLAASMYPDQSLYPAN
SVPSVVDRINNTFRRADQIQWAAGIEPHDPRFIDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDA
DAADLITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ALAKRFADAIHAKYPGKLLAYNCSPSFNWQKNLDDTTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFAAGKEGYTFVSHQQEVGTGYFDNVTTII
QGGASSVTALTGSTEEAQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacccaacagatcgaagagttacaaaaagagtgg
acccaaccgcgctgggaaggcattcgccgtccgtacagcgcagaggaagtggtgaaatta
cgcggctcggttaacccggaatgtacgctggcgcagaacggcgcggcgaaaatgtgggat
ctgctgcatggggggtctaaaaaaggctatatcaacagcctcggcgcgctgaccggcggt
caggcattgcagcaggcgaaggccggcattgaagctatctatctttccggctggcaggtc
gcggcggatgctaacctggccgccagcatgtatccggatcaatctctttatccggcgaac
tcggtgccgtcagtggtggatcggatcaacaataccttccgccgtgcggatcagatccag
tgggccgcgggtatcgaaccccacgatccgcgttttatcgactatttcctgccgatcgtc
gccgatgcggaagccggtttcggcggcgtgctgaacgcctttgagctgatgaaatccatg
attgaggccggtgcagcggccgttcactttgaagatcagctggcgtcggtgaagaagtgc
gggcatatgggcgggaaagtgctggtgccaacccaggaagcgatccagaagctggttgcc
gcgcgtctggctgctgacgtgctcggcgtgccgacgctggtgattgcccgtaccgatgct
gacgcggcggacctgatcacctctgactgcgacccgtatgacagcgaattcattaccggc
gaacgtaccagcgaagggttctatcgcacacatgccggtattgaacaggcgatcagccgc
ggcctggcgtatgccccttacgccgacctggtctggtgtgaaacctccacgccggatctg
gcgctggcgaagcgctttgccgatgcgattcatgcgaagtatccgggcaagctgctggcc
tataactgttcgccgtccttcaactggcaaaagaatctggacgatacgaccatcgccagc
ttccagcagcaattgtcagatatgggctacaagtaccagttcatcaccctggcgggtatc
cacagcatgtggttcaacatgttcgacctggcgcacgcctacgcgcagggcgaaggcatg
aaacactatgttgagaaggtgcagcagccagaatttgcggcgggcaaagaaggatatacc
ttcgtttcgcaccagcaggaagtgggaaccggctacttcgataatgtgaccacgattatt
cagggcggggcctcctccgtcacggcattaacgggctcgacggaagaagcacagttctaa

DBGET integrated database retrieval system