KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_04450Help
Entry
ENC_04450         CDS       T02615                                 

Definition
(RefSeq) isocitrate lyase (EC:4.1.3.1)
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ENC_04450
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ENC_04450
Enzymes [BR:eclo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     ENC_04450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
467584..468903
Genome map
AA seq 439 aa AA seqDB search
MEHLHMKTRTQQIEELQKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQNGAAKMWD
LLHGGSKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLAASMYPDQSLYPAN
SVPSVVDRINNTFRRADQIQWAAGIEPHDPRFIDYFLPIVADAEAGFGGVLNAFELMKSM
IEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDA
DAADLITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDL
ALAKRFADAIHAKYPGKLLAYNCSPSFNWQKNLDDTTIASFQQQLSDMGYKYQFITLAGI
HSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFAAGKEGYTFVSHQQEVGTGYFDNVTTII
QGGASSVTALTGSTEEAQF
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggagcatctgcacatgaaaacccgtacccaacagatcgaagagttacaaaaagagtgg
acccaaccgcgctgggaaggcattcgccgtccgtacagcgcagaggaagtggtgaaatta
cgcggctcggttaacccggaatgtacgctggcgcagaacggcgcggcgaaaatgtgggat
ctgctgcatggggggtctaaaaaaggctatatcaacagcctcggcgcgctgaccggcggt
caggcattgcagcaggcgaaggccggcattgaagctatctatctttccggctggcaggtc
gcggcggatgctaacctggccgccagcatgtatccggatcaatctctttatccggcgaac
tcggtgccgtcagtggtggatcggatcaacaataccttccgccgtgcggatcagatccag
tgggccgcgggtatcgaaccccacgatccgcgttttatcgactatttcctgccgatcgtc
gccgatgcggaagccggtttcggcggcgtgctgaacgcctttgagctgatgaaatccatg
attgaggccggtgcagcggccgttcactttgaagatcagctggcgtcggtgaagaagtgc
gggcatatgggcgggaaagtgctggtgccaacccaggaagcgatccagaagctggttgcc
gcgcgtctggctgctgacgtgctcggcgtgccgacgctggtgattgcccgtaccgatgct
gacgcggcggacctgatcacctctgactgcgacccgtatgacagcgaattcattaccggc
gaacgtaccagcgaagggttctatcgcacacatgccggtattgaacaggcgatcagccgc
ggcctggcgtatgccccttacgccgacctggtctggtgtgaaacctccacgccggatctg
gcgctggcgaagcgctttgccgatgcgattcatgcgaagtatccgggcaagctgctggcc
tataactgttcgccgtccttcaactggcaaaagaatctggacgatacgaccatcgccagc
ttccagcagcaattgtcagatatgggctacaagtaccagttcatcaccctggcgggtatc
cacagcatgtggttcaacatgttcgacctggcgcacgcctacgcgcagggcgaaggcatg
aaacactatgttgagaaggtgcagcagccagaatttgcggcgggcaaagaaggatatacc
ttcgtttcgcaccagcaggaagtgggaaccggctacttcgataatgtgaccacgattatt
cagggcggggcctcctccgtcacggcattaacgggctcgacggaagaagcacagttctaa

DBGET integrated database retrieval system