KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_07960Help
Entry
ENC_07960         CDS       T02615                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ENC_07960
Enzymes [BR:eclo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ENC_07960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
838251..838964
Genome map
AA seq 237 aa AA seqDB search
MAGWRAQPAADDGTKYGTMIHREYYTLIRVLRPMAQLYFYYSAMNAGKSTALLQSSYNYQ
ERGMRTVVYTAEIDDRFGAGKVSSRIGLSSPARLFNPETDLLEDIRAEHASKPVHCVLVD
ESQFLTREQVHALSEVVDELDIPVLCYGLRTDFRGELFAGSQYLLAWSDKLVELKTICFC
GRKASMVLRLDQSGKPYADGEQVVIGGNERYVSVCRKHYKEALAVGSLTALQGDNRK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctggagagcgcagcccgccgctgatgacggtacaaaatatggtacaatgatc
catcgggaatattacacattgattagggttcttcggccaatggcacaactttatttctac
tattcggcaatgaatgcagggaaatcgacggcgttactgcaatcctcatacaattatcag
gagcgggggatgcgtaccgttgtttataccgccgaaatcgacgatcgctttggggcaggg
aaggttagctcaagaatagggctctcgtcgcctgcaaggctgtttaaccctgaaacggac
ctgctggaggacattcgtgccgagcatgcctctaagcctgtccattgcgtgctggtagat
gaaagccagttcctgacccgagagcaggtccatgcactttcagaggtcgttgatgagctg
gatattcccgttctttgctatggattacgtaccgattttcgtggggagttatttgccggc
agtcagtatctgctcgcctggtcggataagctggttgagctgaaaacaatctgcttttgt
ggccgcaaggcaagtatggttcttcgcctggaccagtcgggtaaaccctatgctgatggc
gagcaggtggtgataggaggcaatgaacgttatgtctcggtctgccgcaagcattataaa
gaggcgctggctgtaggctcgctgacggcgttacagggcgacaatcgaaaataa

DBGET integrated database retrieval system