KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_07970Help
Entry
ENC_07970         CDS       T02615                                 

Definition
acetaldehyde dehydrogenase/alcohol dehydrogenase AdhE (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ENC_07970
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ENC_07970
   00620 Pyruvate metabolism
    ENC_07970
   00650 Butanoate metabolism
    ENC_07970
  Lipid metabolism
   00071 Fatty acid degradation
    ENC_07970
  Amino acid metabolism
   00350 Tyrosine metabolism
    ENC_07970
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ENC_07970
   00626 Naphthalene degradation
    ENC_07970
Enzymes [BR:eclo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ENC_07970
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     ENC_07970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(839403..841931)
Genome map
AA seq 842 aa AA seqDB search
MAVAESGMGIVEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIV
PTTNPTSTAIFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWID
QPSVELSNALMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAV
ASVLMSKTFDNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDVILKNGA
LNAAIVGQPAYKIAELAGFSVPATTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKDFDD
AVEKAEKLVAMGGIGHTSCLYTDQDNQPERVAYFGQKMKTARILINTPASQGGIGDLYNF
KLAPSLTLGCGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIAL
DEVITDGHKRALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAEL
ANSFKPDVIIALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAK
MIAVTTTSGTGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMEMPKSLCAFGG
LDAVTHALEAYVSVLASEFSDGQALQALKLLKENLPASYNEGSKNPVARERVHSAATIAG
IAFANAFLGVCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQA
RRRYAEIADHLGLSAPGDRTAAKIEKLLAWLESLKAELGIPKSIREAGVQEADFLAHVDK
LSEDAFDDQCTGANPRYPLISELKQILLDTYYGRNFTESDVAAVKVEIPAVVKADKKAKK
NA
NT seq 2529 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgccgaatccggcatgggtatcgttgaagataaagtgatcaaaaaccacttt
gcttcagagtatatctacaacgcctataaagatgagaaaacctgcggtgtgctgtcagaa
gacgatactttcggcaccatcaccatcgcagaaccgatcggcatcatttgcggtatcgtt
ccaaccactaacccaacctctaccgccatcttcaaatctctcatcagtctgaagacacgt
aacgcaatcattttctccccgcatccacgtgcgaaggacgccaccaacaaagcagcagat
atcgtgcttcaggctgctattgcggcgggtgcaccaaaagatctcatcggctggatcgac
caaccttctgttgaactgtccaacgccctgatgcatcacccggacattaacctgattctg
gcgaccggtggtcctggtatggttaaagcagcgtacagctccggtaaaccagccatcggc
gtaggcgcaggtaatacccctgtggtgatcgacgaaacggctgatatcaagcgtgctgtt
gcctctgtgctgatgtctaaaaccttcgataacggcgttatctgtgcatctgaacagtct
gttgtcgtggttgattcggtatacgacgccgttcgtgaacgtttcgccagccacggcggc
tacctgttgcaaggtaaagaactgaaagccgttcaggacgtgattctgaaaaatggtgcg
ctgaacgcggctatcgtaggtcagcctgcgtataaaatcgctgagctcgctggctttagc
gtccctgctaccaccaagattctgattggtgaagtgaaagtcgttgatgaaagtgagccg
tttgctcacgagaaactctccccgacgctggcaatgtaccgtgcgaaagatttcgatgac
gcggtagaaaaagcagagaaactggtggcgatgggcggtatcggccacacctcttgcctg
tacaccgaccaggataaccagcctgagcgtgttgcttacttcggtcagaagatgaagaca
gcacgtatcctgatcaacacccctgcttctcagggtggtatcggtgacctgtacaacttc
aaactcgcaccttccctgactctgggttgtggttcctggggtggtaactccatctctgaa
aacgttggtccaaaacacctgatcaacaagaaaaccgttgctaagcgagctgaaaacatg
ttgtggcacaaacttccgaaatctatctacttccgccgcggctctctgccaatcgcgctg
gatgaagtgattactgatggccacaaacgtgcgctcatcgtgaccgaccgtttcctgttc
aacaatggctatgcagaccagatcacctctgttctgaaagcggctggcgtcgaaactgaa
gtcttctttgaagttgaagctgacccaaccctgagcgttgtacgtaaaggcgctgaactg
gcgaactccttcaaacctgatgtgatcatcgcactgggtggcggttccccaatggacgcc
gcgaaaattatgtgggtgatgtacgaacatccggaaactcacttcgaagaactggcgctg
cgctttatggatatccgtaaacgtatctacaagttcccgaaaatgggcgtgaaagcgaaa
atgatcgccgtcaccaccacttccggtactggttcagaagtgacgccatttgccgttgtg
actgatgacgcaaccggtcagaaatacccgctggctgactacgcactgacgccagatatg
gctatcgttgacgccaacctggtcatggaaatgccgaaatcactgtgtgcgttcggtggt
ctggatgcggtaactcacgctctggaagcttacgtttccgtactggcctctgagttctct
gacggtcaggctttgcaggcgctgaaactgctgaaagaaaacctgccagcttcttacaac
gaaggttcgaaaaaccctgttgcgcgtgaacgtgtacacagtgcggcaaccatcgcgggc
attgcgtttgctaacgccttcctgggtgtctgtcactccatggcgcacaagctgggttca
cagttccacattcctcacggtctggcgaacgccctgttgatcagcaacgttatccgctat
aacgccaacgacaacccaaccaagcagactgcattcagccagtacgaccgcccacaggcg
cgccgtcgttatgctgaaatcgcagatcacctgggtctgagcgcaccgggcgaccgtact
gccgcgaagatcgagaaactgctggcatggctggagagcctgaaggctgaactgggtatt
cctaaatctatccgcgaagcaggcgttcaggaagctgacttcctcgctcacgtagataag
ctgtctgaagatgcattcgatgaccagtgtactggtgctaacccgcgctacccactgatt
tccgaactgaaacagatcctgctggatacttattacggtcgtaacttcactgaaagcgat
gtcgctgccgtaaaagttgaaatccccgcagttgtaaaggctgacaagaaagcgaagaaa
aatgcttga

DBGET integrated database retrieval system