KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_19710Help
Entry
ENC_19710         CDS       T02615                                 

Definition
Pectin methylesterase (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ENC_19710
   00500 Starch and sucrose metabolism
    ENC_19710
Enzymes [BR:eclo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     ENC_19710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2018409..2019509
Genome map
AA seq 366 aa AA seqDB search
MDPNAAPWTPSSINLPKQPDFVVGPAGAEGVTHTSIQAAVDAAITKHSASRQYIAILPGE
YEGTVYVPAAPGSITLYGLGEKAVDVKIGLAIDSEIDSSTWRHLVNPAGKYMPGKPAWYM
FDNCQRKRAATIGVMCSAVFWSQNNGLQLQNLTIQNTLGDSVDAGNHQAVALRSDGDKVQ
INNVNILGRQNTFFVTNSGVQNTLQNNRLTRTLVTNSYIEGDVDMVSGRGAVVFDNTDFR
VVNSRTQQEGYVFAPATQSNLFYGFLAVNSRFTAAGDGVAQLGRSLDVDSATNGQVVIRD
SVINEGFNMAKPWADAAISKRPFSGNTGTVDDKDNVQRNLNDANFNRMWEYNNRGLGSKV
VAEPKQ
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaatgcagccccgtggacgccttcttctattaacctgccgaaacagccagac
ttcgttgtcggcccggccggggcagagggcgttacacacacctctattcaggcagccgtt
gatgccgcaattaccaaacacagcgcatctcgtcagtacattgccatcctgccgggtgaa
tacgaaggaaccgtttatgttccggcggcaccgggaagcattacgctttacggcctgggc
gaaaaagcggtcgacgtaaaaattggcctggcgattgattcagagatcgacagcagcacc
tggcgccatctggtgaacccggccggtaaatacatgccaggtaaaccggcgtggtatatg
tttgataactgccagcgcaagcgtgccgccaccattggcgtgatgtgttcggcggtattc
tggtcacagaacaatggcctgcaattgcagaacctgaccattcagaacaccctgggcgac
agcgttgacgcaggtaatcatcaggccgtggcgctgcgtagcgatggcgacaaggtacag
attaacaacgtcaatatcctgggccgccagaacaccttcttcgtgaccaacagcggcgtg
cagaatacccttcagaacaaccgtctgacgcgtactctggtcaccaacagctacattgaa
ggcgacgtggatatggtctctggccgcggcgcggtggtatttgataacaccgactttcgc
gtggtgaattcacgtacgcagcaggaaggttacgtctttgccccggccacgcagtctaac
ctgttctatggcttcctggccgtgaatagccgctttactgctgctggcgatggcgtggcg
cagcttggtcgctcgctggacgtggactccgccactaacggccaggtcgtgatccgcgac
agcgtgattaacgaaggctttaacatggcaaaaccgtgggcggatgcggcgatctcgaaa
cgtcctttctccggcaacaccggcacggtggatgataaagacaacgtgcagcgtaacctg
aacgacgctaactttaaccgcatgtgggaatacaacaaccgcggtctgggtagtaaagtg
gttgctgagccgaagcagtaa

DBGET integrated database retrieval system