KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_23280Help
Entry
ENC_23280         CDS       T02615                                 

Definition
L-fuculose 1-phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:eclo00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2375671..2376270
Genome map
AA seq 199 aa AA seqDB search
MTRMGLNQGTAGNISVRYRDGMLITPTGIPYEHLTEESIVYVDAQGRHEEDKLPSSEWRF
HQVVYQTRPDANAVVHNHAVNCTAVSILNRPIPAIHYMIAAAGGNSIPCAPYATFGTRAL
SEHVAVALRDRKATLLQHHGLITCEENLEKALWLAQEVEVLAKLYLATLAIVDPVPVLSD
DEIAIVLEKFKSYGLRVEA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcatggggttaaatcagggcaccgccggcaatatcagcgttcgctatcgcgac
ggcatgctgattacgccgaccggaattccctacgagcatctgaccgaagagagtatcgtc
tatgtagatgcacaggggcggcacgaagaagataaactgccctccagcgaatggcgtttt
catcaggttgtgtatcagacccgcccggatgctaacgccgtcgtccataaccatgcggtt
aactgtaccgccgtctcgatactcaaccgccccattcctgctattcactatatgattgcc
gccgccgggggaaactccattccctgcgccccttacgcgaccttcgggacgcgcgcgctg
tcagagcatgtcgcggtcgcattacgcgatcgcaaagcgacgctcttacagcaccacggc
ctgataacctgcgaagaaaatcttgaaaaggcactgtggctggcgcaggaggtagaggtg
ctggcaaaactctacctggccacgctggcgatagtagatcccgttcctgtactcagtgac
gatgaaattgccattgttcttgagaaattcaaaagctacggattgcgcgtcgaggcgtaa

DBGET integrated database retrieval system