KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_26150Help
Entry
ENC_26150         CDS       T02615                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ENC_26150
Enzymes [BR:eclo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     ENC_26150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2638410..2640488)
Genome map
AA seq 692 aa AA seqDB search
MESKRLDSAAQAAGISLSYINAHGKPQSIGADTKRRLLDAMHKTDAKASGAPVPNVKVFT
AGKKMPLAVEGRGEFSWLLTTEEGHQHKGHATGGKTLNLPAKLPEGYHTLTLTRDDQRFH
CRVIVAPKRCYEPQALREGKKLWGACVQLFTLRSDSNWGIGDFGDLKKMLASVGERGGAF
IGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNALDDFKNSKEAQAWWKLETTQQLL
KQARDADWVDYASVTALKMAALRLAWKGFAKRDDEQMAAFRQFVMQEGESLYWQAAFDAL
HAYQVQEDEMRWGWPVWPEAYQSVDTPEVKAFCETHADEVDFYLWLQWLAYSQFAACWQV
SQGYNMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDPH
VMAARAYEPFIDLLRANMQNCGALRIDHVMSVLRLWWIPYGETADHGAYVQYPVDDLLSI
LALESKRHQCMVIGEDLGTVPVEIVSKLRDSGVYSYKVLYFENDHEKTFRAPKAYPEQSM
AVATTHDLPTLRGYWESGDLTLGKTLGLYPDEEVLRGLYQDRELAKQGLLDALHKHGCLP
KRAGHKASLMSMTPTLNRGLQRYIADSNSALLGLQPEDWIDMAEPVNIPGTSYQYKNWRR
KLSTTLEAMFADDGVNRLIKDLDKRRKAAAKK
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggagagtaaacgtctggacagtgccgcgcaggcggcgggaattagcctcagttacatc
aatgcgcacggcaaaccgcagtctattggtgcggacaccaaaagacgtttgctggatgcc
atgcacaaaaccgacgcgaaagcgtcgggtgcgccggtgccgaacgtcaaggtctttacc
gcgggcaaaaagatgccgctggcggtggaagggcgcggcgagttcagctggctgctcacc
accgaagaggggcatcagcacaaaggccatgccaccggcggcaaaaccctcaaccttccg
gcgaagctgccggagggctaccacacgcttacgcttacacgggacgaccagcgttttcac
tgtcgggtgattgtggcgccaaagcgctgctatgagccgcaggcgctgcgtgaaggcaaa
aagctgtggggcgcctgcgtgcagctctttaccctgcgttcggacagcaactggggcatt
ggcgattttggcgacctgaaaaagatgctggcatctgttggtgagcgcggcggcgcgttc
atcggcctcaacccgatccacgccctctatccggcgaatccggaaagcgccagcccgtac
agcccgtcttcccgtcgctggctgaacgtgatttacatcgacgttaacgcattagacgat
ttcaaaaacagcaaagaggcgcaggcgtggtggaagcttgagaccacgcaacagctgctg
aaacaggcccgcgatgcggactgggttgattacgcctccgttaccgcgctgaaaatggcg
gctctgcgtctggcctggaagggctttgcgaagcgtgacgacgagcagatggcagccttc
cgccagtttgtgatgcaggaaggcgagagcctttactggcaggcagcgtttgatgcgctg
catgcgtatcaggttcaggaggacgagatgcgctggggctggccggtgtggccggaagcc
tatcagtccgttgataccccggaagtgaaggcattctgtgagacgcatgccgacgaggtg
gatttctatctctggttgcagtggctggcgtacagccagtttgccgcctgctggcaggtg
agccagggctataacatgccgatcgggttgtatcgcgatctggccgtcggcgtggcggaa
ggcggggcggaaacctggtgtgaccgtgaactttactgcctgaaagcttctgtgggggcg
ccgccggatattctgggcccgctcggtcagaactggggcttaccgccgatggatccgcac
gtgatggcggcgcgtgcctacgagccgtttatcgacctgctgcgcgctaacatgcagaac
tgcggtgcgttgcgtatcgaccacgtgatgtccgtgctgcgcctgtggtggatcccgtac
ggtgaaacggctgaccacggggcgtacgtgcaatatccggtggacgatctgctctcaatc
ctggcgctggagagtaaacgtcatcagtgcatggtgattggcgaagatctcggtaccgtg
ccggtggaaattgtcagcaagctccgcgacagcggggtttactcctacaaagtgctctat
tttgaaaacgaccatgagaaaaccttccgcgcgccgaaagcgtaccctgaacagtcaatg
gcagtcgcgacgacgcatgatcttcctacgctcagaggctactgggaaagcggtgacctg
acgctcggcaaaacgctgggtctctacccggatgaagaggttctgcgtgggctgtatcag
gatcgcgagctggcgaagcaggggctgctggatgcgctgcataagcatggctgtctgccg
aagcgcgccgggcataaggcgtcgctgatgtcgatgacgccaacgcttaaccgtggctta
cagcgctatattgccgacagcaacagcgcgttgctcggtctgcaaccggaagactggatt
gatatggcggagccggtaaacatccccggcaccagctatcagtacaaaaactggcgtcgc
aagctgtccacaacgcttgaagcgatgtttgccgatgacggggtgaacaggttgattaag
gatttggataaacggcgaaaagcagccgcgaagaagtga

DBGET integrated database retrieval system