KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_27290Help
Entry
ENC_27290         CDS       T02615                                 

Definition
(GenBank) Cellulase family 8 (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2759518..2760588)
Genome map
AA seq 356 aa AA seqDB search
MLAAANLHAACRWPAWETFKQDYMSESGRVIDPSDARKITTSEGQSYGLFFALAANDRKA
FDLLLAWTRDNLAEGDLTQHLPAWLWGKKDDETWAVIDPNSASDADIWIAWSLLEAGRLW
KNPDYTRTGKALLTRIASEEVVKVPGLGSMLLPGKVGFAEESVWRFNPSYLPPQLASYFT
RFGAPWTTLRETNLRLLLETAPKGFSPNWVKYQKKGGWQLSQDASLIGSYDAIRVYLWVG
MMNDNDPQKARLLARFKPMATTTIKQGLPPEKVDVATGKRTGDGPVGFSASLLPFLQNRD
AQAVQRQHVADRFPDNNAYYSYVLTLFGQGWDQHRFRFTVQGELLPDWGQECARSH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggcggcgaatcttcacgccgcctgtcgctggcctgcctgggagacgttcaag
caggattatatgagcgaaagtggacgcgtcattgatcccagtgacgcgcgcaaaatcacc
acctccgaagggcaaagctacggactgttctttgccctcgcggcaaacgatcgcaaggcg
ttcgatctgctgctggcatggacgcgcgataaccttgccgagggagatttaacccaacat
ctcccggcctggctgtgggggaaaaaggacgacgaaacctgggcggttatcgaccctaac
tccgcgtctgatgccgatatctggattgcctggtcgctgctggaagccgggcggctgtgg
aaaaatcccgattacacgcgcacgggtaaggcgctgttgacgcgcattgccagtgaggaa
gtggtgaaggtgccggggctgggttctatgctgctgccgggtaaagtcggttttgccgaa
gagagcgtctggcgcttcaaccccagctacctgccgccgcaacttgcgagctatttcacc
cgttttggcgcgccgtggacgacgctccgtgaaaccaacctgcgtctgctgctggaaacc
gcgcctaaaggattttccccgaactgggtgaaataccagaaaaagggcggctggcagctg
tcgcaggatgcatccctgatcggcagctacgatgcgattcgcgtctatctgtgggtaggg
atgatgaacgataacgatccgcagaaagcccggctactggcgcgtttcaagcccatggcg
accaccacaatcaaacaaggcttgccgccggagaaagtggacgtcgcgaccgggaaacgc
accggagatgggccggtagggttttctgcctccctccttccgtttttacaaaaccgggac
gcgcaagcggtgcaacgccagcacgtcgccgatcgttttcccgataacaatgcttattac
agctacgttctgaccctctttggacaagggtgggatcagcatcgttttcgtttcaccgtg
caaggtgaattactaccggactggggccaggaatgcgcacgttcacactga

DBGET integrated database retrieval system