KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_27290Help
Entry
ENC_27290         CDS       T02615                                 

Definition
(GenBank) Cellulase family 8
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Brite
Enzymes [BR:eclo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     ENC_27290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2759518..2760588)
Genome map
AA seq 356 aa AA seqDB search
MLAAANLHAACRWPAWETFKQDYMSESGRVIDPSDARKITTSEGQSYGLFFALAANDRKA
FDLLLAWTRDNLAEGDLTQHLPAWLWGKKDDETWAVIDPNSASDADIWIAWSLLEAGRLW
KNPDYTRTGKALLTRIASEEVVKVPGLGSMLLPGKVGFAEESVWRFNPSYLPPQLASYFT
RFGAPWTTLRETNLRLLLETAPKGFSPNWVKYQKKGGWQLSQDASLIGSYDAIRVYLWVG
MMNDNDPQKARLLARFKPMATTTIKQGLPPEKVDVATGKRTGDGPVGFSASLLPFLQNRD
AQAVQRQHVADRFPDNNAYYSYVLTLFGQGWDQHRFRFTVQGELLPDWGQECARSH
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggcggcgaatcttcacgccgcctgtcgctggcctgcctgggagacgttcaag
caggattatatgagcgaaagtggacgcgtcattgatcccagtgacgcgcgcaaaatcacc
acctccgaagggcaaagctacggactgttctttgccctcgcggcaaacgatcgcaaggcg
ttcgatctgctgctggcatggacgcgcgataaccttgccgagggagatttaacccaacat
ctcccggcctggctgtgggggaaaaaggacgacgaaacctgggcggttatcgaccctaac
tccgcgtctgatgccgatatctggattgcctggtcgctgctggaagccgggcggctgtgg
aaaaatcccgattacacgcgcacgggtaaggcgctgttgacgcgcattgccagtgaggaa
gtggtgaaggtgccggggctgggttctatgctgctgccgggtaaagtcggttttgccgaa
gagagcgtctggcgcttcaaccccagctacctgccgccgcaacttgcgagctatttcacc
cgttttggcgcgccgtggacgacgctccgtgaaaccaacctgcgtctgctgctggaaacc
gcgcctaaaggattttccccgaactgggtgaaataccagaaaaagggcggctggcagctg
tcgcaggatgcatccctgatcggcagctacgatgcgattcgcgtctatctgtgggtaggg
atgatgaacgataacgatccgcagaaagcccggctactggcgcgtttcaagcccatggcg
accaccacaatcaaacaaggcttgccgccggagaaagtggacgtcgcgaccgggaaacgc
accggagatgggccggtagggttttctgcctccctccttccgtttttacaaaaccgggac
gcgcaagcggtgcaacgccagcacgtcgccgatcgttttcccgataacaatgcttattac
agctacgttctgaccctctttggacaagggtgggatcagcatcgttttcgtttcaccgtg
caaggtgaattactaccggactggggccaggaatgcgcacgttcacactga

DBGET integrated database retrieval system