KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_31290Help
Entry
ENC_31290         CDS       T02615                                 

Definition
Protein-disulfide isomerase (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3160625..3161338)
Genome map
AA seq 237 aa AA seqDB search
MKKSLALLTLLAASVSGIAHADDAAIKQSLTKLGVASSEIQPAPVAGMKTVLTNSGVLYV
TEDGKHIIQGPMYDVSGAQPVNVTNQLLMKNLNALEKEMIVYKAAQEKHVITVFTDITCG
YCHKLHEEMKDYNALGITVRYLAFPRAGVQSQPEQDMKAIWCAKDRNKAFDDAMNGKGVK
PASCDIDIANHYALGVQFGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQMGGK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtctttagcgctgctcaccctgctggcagcttcggtttccggtattgcccat
gcggacgatgccgccattaaacagtctctgacgaaactcggcgtcgccagcagcgagatc
cagccagcgccggtggctggcatgaaaacggtgctgaccaacagcggcgtgctgtacgtg
accgaagacggcaaacacatcattcaggggcctatgtacgacgtgagcggcgcgcagccg
gtgaacgtcactaaccagctgctgatgaaaaacctgaacgcgctcgaaaaagagatgatt
gtctacaaagcggcgcaggaaaagcacgttattaccgtcttcaccgacatcacctgcggc
tactgccacaagctgcatgaagagatgaaagactacaacgcgctgggcattaccgtgcgt
tacctggctttcccacgcgccggcgtgcagagccagcctgagcaggatatgaaagcgatc
tggtgtgcgaaagaccgcaacaaggcctttgatgacgcgatgaacggcaaaggcgtgaag
cccgcgtcctgcgatatcgacatcgctaaccactacgcgctgggcgtacagtttggcgtg
agcggtacgccagccattgtgctgagtaacggctacgtggtgccgggctaccaggggcca
aaagagatgaaagcgttcctcgacgagcaccagaaacagatgggtggtaaataa

DBGET integrated database retrieval system