KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_39210Help
Entry
ENC_39210         CDS       T02615                                 

Definition
(GenBank) Aspartate/tyrosine/aromatic aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
eclo00220  Arginine biosynthesis
eclo00250  Alanine, aspartate and glutamate metabolism
eclo00290  Valine, leucine and isoleucine biosynthesis
eclo01100  Metabolic pathways
eclo01110  Biosynthesis of secondary metabolites
eclo01130  Biosynthesis of antibiotics
eclo01210  2-Oxocarboxylic acid metabolism
eclo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ENC_39210
   00290 Valine, leucine and isoleucine biosynthesis
    ENC_39210
   00220 Arginine biosynthesis
    ENC_39210
Enzymes [BR:eclo01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     ENC_39210
    2.6.1.66  valine---pyruvate transaminase
     ENC_39210
Amino acid related enzymes [BR:eclo01007]
 Aminotransferase (transaminase)
  Class I
   ENC_39210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CBK87162
Position
complement(3970898..3972112)
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFEAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDAAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
VPGGRLYEQRNRAWELINDIPGVSCVKPNGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHVRIVTLPREDDLEMAISRFGRFLSGYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctatcgaaaaatccagcaagctcgacaacgtctgttacgacatccgtggcccg
gtactcaaagaggcaaaacgccttgaagaggaaggcaataaggttctgaaactcaacatc
ggcaaccccgcgccatttggttttgaagcgccggatgagatcctggtggatgtgatccgt
aacctgcccactgcacaaggctactgcgattcaaaagggctttattccgcccgtaaagcc
atcatgcagcactatcaggctcgcggtatgcgcgacgtcaccgttgaagatatctacatt
ggcaacggtgtctcggagctgatcgttcaggcgatgcaggcgctcctgaacagcggcgat
gaaatgctggttcctgccccggattatccgctgtggacggctgcggtgtccctgtccagc
ggtaaagcggtgcactacctgtgcgacgaatcctctgactggttcccggatctggatgat
attcgcgccaaaattaccccgcgcacccggggtatcgtgatcattaacccgaataacccg
acgggtgcggtctattcaaaagagctgctgatggagatcgtcgagatcgcccgccagcac
aacctgatcatctttgccgacgagatttacgacaagatcctgtacgacgcggcgcagcac
cactctatcgccgcgctggcgcccgatctgctgacggtcacctttaatggactgtctaaa
acttaccgcgttgccggtttccgtcagggctggatggtactgaacggtccgaaaaaacat
gcgaaaggctacattgaagggctggagatgctggcatccatgcgtctgtgcgccaacgta
ccggcgcaacatgcgatccagacagctctcggcggctatcaaagcatcagcgagtttatc
gttccaggcggccgcctgtatgaacagcgcaaccgcgcatgggaattgattaatgatatt
ccgggcgtctcctgcgtgaagcctaacggcgcgctgtacatgttcccgaaaatcgacgcg
aagcgcttcaatattcacgacgaccagaaaatggtgctcgacttcctgttgcaggaaaaa
gtgctactggttcaggggacggcgtttaactggccgtggccggatcacgtgcgtatcgtc
accttgccgcgcgaagacgatctcgagatggccatcagccgcttcgggcgcttcctctcc
gggtaccatcagtaa

DBGET integrated database retrieval system