KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_45050Help
Entry
ENC_45050         CDS       T02615                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    ENC_45050
Enzymes [BR:eclo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     ENC_45050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4587249..4588583
Genome map
AA seq 444 aa AA seqDB search
MEVTVFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMSMPER
VSLTMAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRG
LGHTGGTLDKLEAIPGFDIFPDDNRFRDIIKDVGVAIIGQTSSLAPADKRFYATRDITAT
VDSIPLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVSNGAGVRTT
ALLTDMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTTALCVEMLISGKLAKDDAEA
RAKLQAVLDNGKAAEIFGRMVAAQKGPTDFVENYAKYLPTAMLSKAVYADSEGFVSAMDT
RALGMAVVSMGGGRRQASDTIDYSVGFTDMARLGDSVDGQRPLAVIHAKDEASWQDAAKA
VKAAISLDDKAPETTPTVYRRITE
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggaggttaccgtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgca
ttaagcgacgaagaaatccgcttttttatcaatggcattcgtgataacaccatctctgaa
gggcagattgcggctctggcgatgaccattttcttccacgatatgtcgatgcctgagcgc
gtgtcgctgaccatggcgatgcgagattcaggaaccgttctggactggaaaagcctcaac
ctcaacggcccgattgtggacaaacactccaccggcggcgtgggcgacgtgacctccctg
atgcttggcccgatggtggcagcctgtggcggttacatcccgatgatttccgggcgcggc
ctgggtcataccggcggtacgctcgacaaactggaagccattccgggcttcgatatcttc
ccggatgacaaccgcttccgcgacattattaaagacgttggcgtggcgattatcggccag
accagctctcttgctccggctgacaagcgtttctacgcgacgcgtgacattaccgcgacc
gtagactccatcccgctgatcaccgcctctatccttgccaaaaaactggcggaaggtctg
gatgcgctggtgatggatgtgaaagtgggcagcggcgcgtttatgccgacctatgaactc
tctgaggcgctggccgaagcgatcgttggcgtctccaacggcgcgggcgtgcgcaccact
gcactgctgacggacatgaaccaggtgctggcctccagcgccggtaacgcggttgaagtc
cgtgaggccgtgcagttcctcacaggcgaataccgtaacccgcgcctgttcgatgtcacc
acggcgctgtgcgttgagatgttaatctccggcaagctggccaaagacgacgcggaagcc
cgcgcgaagcttcaggcggtgctggacaacggcaaagcggcggagatctttggtcggatg
gtggcggcgcagaaaggcccgaccgacttcgtggaaaactacgcgaaatacctgcccacc
gcgatgctcagcaaagcggtctatgcggacagcgaaggctttgtctcggctatggatacc
cgcgcgctcggcatggctgttgtgtctatgggcggcggtcgtcgtcaggcatcggacacc
attgattacagcgtcggctttaccgatatggcccgtctgggcgacagcgttgacggccaa
cgtccgctggcggtgatccacgcgaaagatgaagccagctggcaggacgcggcgaaagcg
gtgaaggcggcaatatctcttgacgataaagcaccggaaaccacaccgacggtctatcgt
cgtatcactgaatag

DBGET integrated database retrieval system