KEGG   Enterobacter cloacae subsp. cloacae NCTC 9394: ENC_47340Help
Entry
ENC_47340         CDS       T02615                                 

Definition
D-xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
eclo  Enterobacter cloacae subsp. cloacae NCTC 9394
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eclo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ENC_47340
   00051 Fructose and mannose metabolism
    ENC_47340
Enzymes [BR:eclo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     ENC_47340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4846517..4847902)
Genome map
AA seq 461 aa AA seqDB search
MSIHYYSRSKTTPHTLIMELNMQAYFDQLDRVRFEGTKTTNPLAFRHYNPDELVLGKRME
DHLRFAACYWHTFCWNGADMFGVGSFDRPWQQPGEAIELAKRKADVAFEFFHKLNVPYYC
FHDVDVSPEGASLKEYLNNFAQMVDVLAEKQQQSGVKLLWGTANCFTNPRYGAGAATNPD
PEVFSWAATQVVTAMNATHQLGGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVDH
KHKIGFRGTLLIEPKPQEPTKHQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSF
HHEIASAIALGIFGSVDANRGDPQLGWDTDQFPNSVEENALVMYEIIKAGGFTTGGLNFD
AKVRRQSTDKYDLFYGHIGAMDTMALALKVAARMIEDGELDKRVAKRYSGWNSELGQQIL
KGQLSLAEIAKYAEQHQLAPQHQSGHQELLENLVNHYLFDK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtctattcactattactccagaagcaagaccacgccgcataccctgattatggagctc
aatatgcaagcttatttcgaccaactcgatcgcgttcgtttcgaaggcacgaaaacgacc
aatcctttagcatttcgtcactacaacccggatgagctggtgctgggtaagcgcatggaa
gatcacttgcgctttgccgcctgctactggcacaccttctgctggaacggtgccgatatg
ttcggcgtgggctcttttgaccgtccatggcaacagccgggcgaggccattgagctggcg
aagcgtaaagccgacgtcgcgttcgagttcttccataagctgaacgtgccgtactactgt
ttccacgatgtggacgtgtcgccggaaggggcatcgctgaaagagtatctgaacaatttc
gcgcagatggtcgacgtactggctgaaaaacagcagcaaagcggcgtcaagctgctctgg
ggtacggctaactgctttaccaatcctcgctatggcgcgggtgcggcaaccaacccggac
ccggaagtcttcagctgggcggcaacccaggtcgtgaccgcgatgaacgccacgcatcag
ctgggcggtgagaactatgtactctggggcggtcgtgaaggctatgaaacgctgctgaat
accgacctgcgtcaggagcgtgagcagattggtcgctttatgcagatggttgtggaccac
aaacacaaaatcggtttccgcggcacgctgctgattgagccaaaaccacaggagccaacc
aagcatcagtatgattatgatgtcgccaccgtgtatggcttcctgaagcagtttggtctg
gaaaaagagatcaaagtgaatattgaggctaaccacgctaccctggcgggccactcgttc
catcacgaaattgcctctgcgattgcgctgggcatcttcggctctgtcgatgctaaccgt
ggtgatccacagctgggctgggataccgaccagttcccgaacagcgtggaagagaatgcg
ctggtgatgtacgagatcatcaaagcgggcggtttcaccaccggcggcctgaacttcgac
gccaaagtgcgtcgccagagcaccgacaaatacgatctgttctacgggcatattggcgcg
atggacaccatggcgctggcgctgaaagtggcggcccgtatgattgaagacggtgagctg
gataagcgcgtggcgaagcgctacagcggctggaacagtgagctgggccagcaaattttg
aaaggtcagttatcgcttgcggagatcgcgaagtacgctgaacagcatcagcttgcgccg
cagcatcagagtggccatcaggagctgctggaaaacctggtcaatcactacctgttcgat
aaataa

DBGET integrated database retrieval system