KEGG   Enterobacter cloacae complex sp. 35734: LI67_014330Help
Entry
LI67_014330       CDS       T04878                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
ecls  Enterobacter cloacae complex sp. 35734
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecls00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    LI67_014330
   00500 Starch and sucrose metabolism
    LI67_014330
Enzymes [BR:ecls01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     LI67_014330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
1:2835209..2836615
Genome map
AA seq 468 aa AA seqDB search
MTLPSRWPAILQAVMTGQPRALADSHYPQWHAAPVTGLMNDPNGFIWFAGRYHLFYQWNP
LDCEHRFKCWGHWSSADLVHWQHEPLALMPDEDYDRNGCYSGSAVDNQGVLTLCYTGNVK
FDDGSRTAWQCLAVEQPDGTFTKLGPVLALPEGYTGHVRDPKVWQHEGMWYMVLGAQDVQ
KRGKVLLFKSADLHAWTSCEEIAGHGVNGLTDAGYMWECPDLFALDGTHVLICCPQGLAR
EPHRYLNTYPATWMSGAFDYARATFNHGELHELDAGFEFYAPQTTLAEDGRRILIGWMGV
PDGEEMLQPTRAHGWMHQMTCPRELRFRDGRLWQTPARELAALREDEQHWQGRASDAPEL
DATRLEFELSASQVNVDFGGALRLTLDEQGVRLERASLKTGETLARYWQGDVRHLRVLCD
RSSVEIFINHGEGVMSSRYFPDHPARVRFEGASDITLRYWSLRACMIE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgacgttaccttcccgctggcctgcgatcctgcaggccgttatgacaggtcagccgcgg
gcgctggcggacagccattatccgcaatggcacgccgcgccggtgacggggctgatgaac
gacccgaacgggtttatctggtttgctggccgctatcacctgttctatcagtggaacccg
ctggactgcgagcaccgctttaagtgctgggggcactggagttctgcggacctggtgcac
tggcagcatgagccgctggcgctgatgccggatgaagattatgaccgcaacggctgctac
tccggtagcgccgtcgataaccagggcgtactgaccctgtgctacaccggcaacgtcaag
ttcgatgacggcagccgcaccgcctggcagtgcctggccgtggagcagccggacgggacc
tttacgaagctggggccggtgctggcgctgccggaaggctacactggccacgtgcgcgac
ccgaaggtgtggcagcatgaggggatgtggtacatggtgctcggcgcgcaggatgtgcag
aagcgcggcaaggtgctgctctttaaatcagccgatttgcacgcctggacatcctgcgag
gagatcgccggtcacggggttaacggcctgacggacgcgggctatatgtgggagtgtccg
gacctgtttgccctcgacgggacgcacgtcctgatctgctgcccgcaggggcttgcgcgc
gagccgcatcgctacctcaatacctatccggctacctggatgagcggggcgtttgactat
gcccgcgcgacgttcaatcacggcgagctgcacgaactggacgcggggtttgaattctac
gccccgcaaaccacgcttgcggaagatggacgccgcatcctgattggctggatgggcgta
ccggacggggaagagatgcttcagcccacgcgggcgcacggctggatgcaccagatgacc
tgcccgcgagaattgcgcttccgcgacggccggctctggcaaaccccggcgcgcgagctg
gcggcgctgcgtgaagatgagcagcactggcaggggcgcgccagcgacgcgcccgaactg
gacgcgacgcgcctggagtttgagctgagcgcatcgcaggtgaatgtcgattttggcggc
gcgctgcgcctcacgctcgatgagcagggcgtgcgcctggagcgcgcgagcctgaaaacc
ggtgaaacattggcccgctactggcagggcgacgtccgtcatttgcgcgtcctatgcgac
cgctccagcgttgaaattttcattaaccacggcgaaggggtgatgagcagccgctatttt
cctgaccatccggctcgggtgcgattcgaaggtgcgtccgatatcacattacgctactgg
tcgctgcgcgcctgcatgatagaatga

DBGET integrated database retrieval system