KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_1468Help
Entry
EcSMS35_1468      CDS       T00672                                 

Gene name
pfkB
Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00010  Glycolysis / Gluconeogenesis
ecm00030  Pentose phosphate pathway
ecm00051  Fructose and mannose metabolism
ecm00052  Galactose metabolism
ecm00680  Methane metabolism
ecm01100  Metabolic pathways
ecm01110  Biosynthesis of secondary metabolites
ecm01120  Microbial metabolism in diverse environments
ecm01130  Biosynthesis of antibiotics
ecm01200  Carbon metabolism
ecm01230  Biosynthesis of amino acids
Module
ecm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcSMS35_1468 (pfkB)
   00030 Pentose phosphate pathway
    EcSMS35_1468 (pfkB)
   00051 Fructose and mannose metabolism
    EcSMS35_1468 (pfkB)
   00052 Galactose metabolism
    EcSMS35_1468 (pfkB)
  Energy metabolism
   00680 Methane metabolism
    EcSMS35_1468 (pfkB)
Enzymes [BR:ecm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EcSMS35_1468 (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617
Motif
Other DBs
NCBI-ProteinID: ACB16852
UniProt: B1LE08
Structure
PDB: 

Jmol
Position
complement(1451588..1452517)
Genome map
AA seq 309 aa AA seqDB search
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVDAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQNQGIRCIVDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtatctatacgttgacacttgcgccctctctcgatagcgcaacaattaccccg
caaatttatcccgaaggaaaactgcgctgtaccgcaccggtgttcgaacccgggggcggc
ggcatcaacgtcgcccgcgccattgcccatcttggaggcagtgccacagcgatcttcccg
gcgggtggtgcgaccggcgaacacctggtttcactgttggcggatgaaaatgtccccgtc
gctactgtagacgccaaagactggacccggcagaatttacacgtacatgtggaagcaagc
ggtgagcagtatcgttttgttatgccaggcgcggcattaaatgaagatgagtttcgccag
cttgaagagcaagttctggaaattgaatccggtgctatcctggtcataagcggaagcctg
ccgccaggtgtgaagctggaaaaattaacccaactgatttccgctgcgcaaaaccaaggg
atccgctgtatcgtcgacagttctggcgaagcgttaagtgcagcactggcgattggtaac
atcgagttggttaagcctaaccaaaaagaactcagtgcgctggtgaatcgcgaactcacc
cagccagacgatgtccgcaaagccgcgcaggaaattgttaatagcggcaaggccaaacga
gttgtcgtttccctgggtccacaaggggcgttgggcgttgatagtgaaaactgcattcag
gttgtgccaccaccggtgaaaagccagagcaccgttggcgctggtgacagcatggtcggc
gcgatgacactgaaactggcagaaaatgcctctcttgaagagatggtccgttttggcgta
gctgcggggagtgcagccacactcaatcagggaacacgcctgtgctcccatgacgataca
caaaaaatttacgcttacctttcccgctaa

DBGET integrated database retrieval system