KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_1637Help
Entry
EcSMS35_1637      CDS       T00672                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ecm00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1627429..1628868
Genome map
AA seq 479 aa AA seqDB search
MSGFKKGFLWGGAVAAHQLEGGWNEGGKGISIADVMTAGAHGVPREVTEGIIDGLNYPNH
EAIDFYHRYKTDIQLFAEMGFKCFRTSIAWTRIFPQGDEQEPNEEGLQFYDDLFDECLKQ
GMEPVVTLSHFEMPYHLVTKYGGWRHRKLIDFFIRFASTVFTRYKEKVKYWMTFNEINNQ
VNFSESLCPFTNSGILYSPEEDINEREQIMYQAVHYELVASALAVQTGKSINPEFNIGCM
IAMCPIYPLTCAPNDMMMATKAMHRRYWFTDVHARGYYPQHMLNYFARKGFNLDITPEDN
TILARGCVDFIGFSYYMSFTTQFSPDNPQLNYVEPRDLVSNPYIDTSEWGWQIDPAGLRY
SLNWFWDHFQLPLFIVENGLGAVDQRQADGTVNDHYRIEYFASHIREMKKAVVEDGVDLI
GYTPWGCIDLVSAGTGEMKKRYGMIYVDKDNEGKGTLERIRKASFYWYRDLIANNGENI
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatttaaaaaaggttttttatggggtggcgcggtagccgcgcatcagttggaa
ggtggctggaatgaaggaggaaaaggcatcagtatcgctgatgtgatgactgctggcgct
cacggggtgccgcgtgaagtgacagaaggcattatcgacgggcttaattatcccaatcat
gaagcaattgatttttatcatcgctataaaacagatattcagttatttgccgagatggga
ttcaaatgctttcgaacttccattgcctggacacgaatctttccgcaaggtgacgaacag
gagccgaatgaagagggtttacaattttatgatgatctgttcgatgaatgcctgaagcag
ggaatggagcctgtggtgacgctttcgcattttgagatgccttatcatctggtgacaaaa
tatggtggctggcgacaccgtaaactgatcgactttttcatccgcttcgcatcaacggtc
ttcacgcgctataaagaaaaagtaaagtactggatgacgtttaacgaaatcaataatcag
gtgaatttcagcgaaagcctgtgtccatttactaattccggtatcttgtattcgccagag
gaagatatcaatgagcgcgaacaaataatgtaccaggcggtacattacgagttagttgcc
agtgccctggcggtacagactggaaaatcgatcaatcctgaatttaatatcggctgtatg
atcgccatgtgccccatctatcctctgacgtgtgcacccaacgatatgatgatggccacg
aaagcgatgcatcgtcgttactggtttactgatgttcatgcgcgtggatattatccgcaa
catatgctgaattactttgccaggaaaggattcaacctcgatatcacaccagaagataac
acgattcttgccagaggttgtgtcgactttatcggttttagctactacatgtcttttact
acgcaattttcgccagataacccgcaactgaattatgttgaaccacgagatttggtcagc
aacccttatatcgatacatccgaatggggatggcaaattgatccggcagggctacgttat
tcactcaactggttctgggatcatttccagttgccgctgtttattgtcgaaaatggattg
ggtgcggttgaccagagacaagctgacggcacggtgaacgatcactatcgcattgagtac
tttgcttcccatattcgggaaatgaaaaaagccgttgttgaagatggtgttgacttaatt
ggctacacaccgtggggctgcattgacctggtttctgccggaacaggggaaatgaaaaaa
cgctacggaatgatttatgtcgataaagacaacgaagggaagggaacgctggaaaggata
cgtaaagcgtcgttttactggtatcgggatctcatcgccaacaatggcgaaaatatttga

DBGET integrated database retrieval system