KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_1696Help
Entry
EcSMS35_1696      CDS       T00672                                 

Definition
(GenBank) oxidoreductase, zinc-binding dehydrogenase family
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00010  Glycolysis / Gluconeogenesis
ecm00071  Fatty acid degradation
ecm00350  Tyrosine metabolism
ecm00625  Chloroalkane and chloroalkene degradation
ecm00626  Naphthalene degradation
ecm01100  Metabolic pathways
ecm01110  Biosynthesis of secondary metabolites
ecm01120  Microbial metabolism in diverse environments
ecm01130  Biosynthesis of antibiotics
ecm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcSMS35_1696
  Lipid metabolism
   00071 Fatty acid degradation
    EcSMS35_1696
  Amino acid metabolism
   00350 Tyrosine metabolism
    EcSMS35_1696
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EcSMS35_1696
   00626 Naphthalene degradation
    EcSMS35_1696
Enzymes [BR:ecm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EcSMS35_1696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31 Phage_holin_2_1
Motif
Other DBs
NCBI-ProteinID: ACB17489
UniProt: B1LFD9
Structure
PDB: 

Jmol
Position
1698310..1699320
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtgattctgggacacgaaggt
attggtgtggtggcagaagttggcccaggtgtcacttcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctatgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagtaaaaaatgccggatacagcgttgatggcgggatggctgaagaa
tgcatcgtggtcgccgattacgcggttaaagtgccggatggcctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaagctgtcaaaaattcgt
ccagggcagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgccaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggcgctgatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggaaaaaaccggtggcgctcacgctgcggtggtgacagcggtagctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcgggcgtgttgtggcagtcggtctg
ccgccggagtctatgagcctggatatcccacgccttgtgctggatggtattgaagtggtc
ggttcgctggtcggcacgcgccaggatttaactgaagccttccagtttgccgccgaaggc
aaagtggtaccgaaggtcgccctgcgtccgttagcggacatcaacacaatctttactgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgctaa

DBGET integrated database retrieval system