KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_1813Help
Entry
EcSMS35_1813      CDS       T00672                                 

Definition
alpha amylase family protein
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    EcSMS35_1813
Enzymes [BR:ecm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     EcSMS35_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1833953..1835632)
Genome map
AA seq 559 aa AA seqDB search
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITLRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYPQWLQSIFSHVHLLPFYPWSSDDGFSVIDYQQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQQPGFEDFFIAVDPQTDLSVVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLEKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDDVAPGTVIITETNVPHRDNIAYFGNGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPESEILALVEA
LQQEGALVNWKNNPDGTRSPYEMNVTYMDALNRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYYSKEITTELNNKTTLRHAVYHELSRLIKIR
RSHNEFHPDNDFTIDTVNSSVMCIQRSNADGNCLTGLFNVSENIQHINITDLHGRDLISE
VDIVGNEITLRPWQVMWIK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagaaaattacggattacctggacgaaatctacggtggaacatttaccgcaact
catttacagaaacttgtaacgcgtcttgagagtgcgaaacgattaattacactgcgacgt
aaaaaacactgggatgaaagtgatgtcgtgttaatcacctatgccgatcaatttcacagt
aatgatttaaaaccactacccacatttaatcagttttaccctcaatggctgcaaagcatt
ttttcacatgttcatttattacctttttatccatggtcatctgatgatggcttttcggta
attgattatcaacaggtcgctagtgaagcgggggagtggcaggatattcagcaactcggt
gaatgcagtcatttaatgtttgattttgtctgcaaccatatgtcggcaaaaagtgaatgg
tttaaaaactatttacaacagcagccaggttttgaagatttttttattgccgttgacccg
caaaccgatctcagcgtcgtcactcgcccgcgtgcgttaccgttattaacgccattccag
atgcgcgatcattcaacgcgccatttatggaccacctttagtgacgatcaaattgacctg
aattaccgtagccctgaagtgttactggcgatggtggatgtattgctgtgctacctggaa
aagggcgcagaatatgtccgtctggatgccgttggctttatgtggaaagagccgggaaca
agctgcatccatctggaaaaaacacatctgattatcaaactgttacggtcgattattgat
gacgtagcaccaggtacagtgatcattaccgagaccaatgttccgcacagagacaacatt
gcttactttggcaacggtgatgacgaagcgcatatggtgtaccagttctcgctgccgccg
ctggtgctgcatgcggtgcaaaaacagaacgttgaggcgctttgtgcgtgggcgcaaaac
ctgacactaccttccagcaacaccacctggtttaacttcctcgcctctcacgatggcatc
gggcttaacccactgcgtggcttgctacccgaaagcgaaatattagcgctggtcgaggca
ttacagcaggaaggggcattagttaactggaaaaataatcccgacggtacgcgtagcccg
tatgaaatgaatgtcacttatatggatgcgttaaaccgccgcgagagtagcgatgaagaa
cgttgcgccaggtttatccttgcccatgcgattttgttaagtttccccggtgtgccagcg
atatatattcaaagtattctgggctcgcgtaatgattacgcaggtgtcgaaaaactggga
tataaccgtgcgattaaccgtaaaaaatattacagtaaagagatcacgaccgaactgaac
aataaaacgacgttaaggcacgcggtatatcatgaattgtcgcgactaattaaaattcgt
cgaagtcataacgagtttcatccagataatgattttaccatcgacacggttaattcatcc
gtaatgtgtattcaaagaagcaacgcggatggtaattgtctgacaggattgtttaatgtc
agtgaaaatattcagcatataaatattactgacctgcacggtcgggatctgattagtgaa
gttgatatagtgggtaatgaaataacgctgcgcccctggcaggttatgtggattaaataa

DBGET integrated database retrieval system