KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_1872Help
Entry
EcSMS35_1872      CDS       T00672                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00260  Glycine, serine and threonine metabolism
ecm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ecm01100  Metabolic pathways
ecm01110  Biosynthesis of secondary metabolites
ecm01130  Biosynthesis of antibiotics
ecm01230  Biosynthesis of amino acids
Module
ecm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EcSMS35_1872 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EcSMS35_1872 (trpA)
Enzymes [BR:ecm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EcSMS35_1872 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA HMGL-like His_biosynth
Motif
Other DBs
NCBI-ProteinID: ACB18679
UniProt: B1LH32
Structure
PDB: 

Jmol
Position
1897190..1897996
Genome map
AA seq 268 aa AA seqDB search
MERYESLFARLKERKEGAFVPFVTLGDPGIEQSLKIIDALIEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPAQCFEMLALIRQKHPTIPIGLLMYANLVFNKGIDEFYAQCEK
AGVDSVLVADVPVEESAPFRQAALRHNVAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLNHLVTKLKEYNAAPPLQGFGISAPDQVKAAIDAGAAGAISGSAIVKI
IEQHINEPEKMLAALKAFVQPMKAATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgaatctctgtttgcccgtttgaaggagcgcaaagaaggcgcattcgtt
cctttcgtcaccctcggtgatccgggcattgagcagtcgctgaaaattatcgatgcgcta
attgaagccggtgctgacgcgctggagttaggcatccccttctccgacccactggcagat
ggcccgacgattcaaaacgccacactgcgtgcctttgcggcaggtgtgaccccggcgcag
tgctttgagatgctggcactcattcgccagaaacacccgaccattcccattggcctgctg
atgtatgccaacctggtgtttaacaaaggcattgatgagttttatgcccagtgcgaaaaa
gccggcgtcgattcggtgctggttgccgatgtgcccgtggaagagtccgcgcccttccgc
caggccgcgttgcgtcataatgtcgcacctatctttatctgcccgccaaatgccgatgac
gacctgctgcgccagatagcctcttacggtcgtggttacacctatttattgtcgcgtgcg
ggcgtgaccggcgcagaaaaccgcgccgcgttacccctcaatcatctggtcacgaagctg
aaagaatacaatgctgcgcctccattgcagggatttggtatttccgccccggatcaggta
aaagcagcgattgatgcaggagctgcgggcgcgatttctggttcggccatcgttaaaatc
atcgagcaacatattaatgagccagagaaaatgctggcggcactgaaagcttttgtacaa
ccgatgaaagcggcgacgcgcagttaa

DBGET integrated database retrieval system