KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_1905Help
Entry
EcSMS35_1905      CDS       T00672                                 

Gene name
galU
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00040  Pentose and glucuronate interconversions
ecm00052  Galactose metabolism
ecm00500  Starch and sucrose metabolism
ecm00520  Amino sugar and nucleotide sugar metabolism
ecm01100  Metabolic pathways
ecm01130  Biosynthesis of antibiotics
Module
ecm_M00362  Nucleotide sugar biosynthesis, prokaryotes
ecm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EcSMS35_1905 (galU)
   00052 Galactose metabolism
    EcSMS35_1905 (galU)
   00500 Starch and sucrose metabolism
    EcSMS35_1905 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EcSMS35_1905 (galU)
Enzymes [BR:ecm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EcSMS35_1905 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ACB17379
UniProt: B1LH65
Structure
PDB: 

Jmol
Position
complement(1925916..1926824)
Genome map
AA seq 302 aa AA seqDB search
MAAINTKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVADVTAYGV
VDCKGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGSEFKAWLEEEMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccattaatacgaaagtcaaaaaagccgttatccccgttgcgggattaggaacc
aggatgttgccggcgacgaaagccatcccgaaagagatgctgccacttgtcgataagcca
ttaattcaatacgtcgtgaatgaatgtattgcggctggcattactgaaattgtgctggtt
actcactcatctaaaaactctattgaaaaccactttgataccagttttgaactggaagca
atgctggaaaaacgtgtaaaacgtcaactgcttgatgaagtgcagtctatttgtccgccg
cacgtgactattatgcaagttcgtcaggggctggcgaaaggcctgggacacgcggtattg
tgtgctcacccggtagtgggtgatgaacctgtggctgttattttgcctgacgttattctg
gatgaatatgaatccgatttgtcacaggataacctggcagagatgatccgccgctttgat
gaaacgggtcatagccagatcatggttgaaccggttgctgatgtgaccgcatatggcgtt
gtggattgcaaaggcgttgaattagcgccgggtgaaagcgtaccgatggttggcgtggtt
gaaaaaccaaaagcggatgttgcgccgtctaatctcgctattgtgggtcgttacgttctt
agcgcggatatttggccgttgctggcaaaaacccctccgggtgctggtgatgaaattcag
ctcaccgacgcaattgatatgctgatcgaaaaagaaacggtggaagcctatcatatgaaa
gggaagagccatgactgcggtaataaattaggttacatgcaggccttcgttgaatacggt
attcgtcataacacccttggctcggaatttaaagcctggcttgaagaagagatgggcatt
aagaagtaa

DBGET integrated database retrieval system