KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_2840Help
Entry
EcSMS35_2840      CDS       T00672                                 

Gene name
ascB
Definition
cryptic 6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcSMS35_2840 (ascB)
Enzymes [BR:ecm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EcSMS35_2840 (ascB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2916156..2917580
Genome map
AA seq 474 aa AA seqDB search
MSVFPEGFLWGGALAANQSEGAFREGGKGLTTVDMIPHGEHRMAVKLGLEKRFQLRDDEF
YPSHEATDFYHRYKEDIALMAEMGFKVFRTSIAWSRLFPQGDELTPNQQGIAFYRAVFEE
CKKYGIEPLVTLCHFDVPMHLVTEYGSWRNRKLVEFFSRYARTCFEAFDGLVKYWLTFNE
INIMLHSPFSGAGLVFEEGENQDQVKYQAAHHQLVASALATKIAHEVNPQNQVGCMLAGG
NFYPYSCKPEDVWAALEKDRENLFFIDVQARGAYPAYSARVFREKGVTINKAPGDDEILK
NTVDFVSFSYYASRCASAEMNANNSSAANVVKSLRNPYLQVSDWGWGIDPLGLRITMNMM
YDRYQKPLFLVENGLGAKDEFAANGEINDDYRISYLREHIRAMGEAIADGIPLMGYTTWG
CIDLVSASTGEMSKRYGFVYVDRDDAGNGTLARTRKKSFWWYKKVIASNGEDLE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtatttccagaaggttttttatggggcggcgcgcttgccgccaaccagtctgaa
ggtgcgttccgtgaaggtggcaaagggctgaccaccgtcgatatgatcccacacggcgag
catcgaatggcggtgaaactggggctggaaaaacgttttcagttgcgcgatgacgagttt
tatcccagccatgaggcgacggatttttatcatcgttataaagaagatatcgccctgatg
gcagagatgggattcaaagtgttccgtacctcaattgcctggagccgcctcttcccgcag
ggcgatgaactgacgcccaaccagcagggcattgctttttatcgcgcggtatttgaagag
tgtaaaaagtacggtatcgaaccgctggtcacgttgtgccacttcgatgtgccgatgcat
ctggtcaccgaatatggctcctggcgtaaccgcaagctggtggagtttttcagccgctac
gcccggacctgctttgaagcatttgatggtctggtgaaatactggcttaccttcaatgaa
atcaacattatgttgcatagcccgttctccggcgcgggtctggtgtttgaagaaggggaa
aatcaggatcaggtgaaatatcaggccgcgcatcaccagctggttgccagtgcgctagct
accaaaatcgcccatgaggttaacccgcaaaatcaggtgggctgtatgctggcgggcggc
aacttctacccttacagttgcaagccggaggatgtctgggcggcgttggagaaagaccgg
gaaaacctgttttttatcgatgtgcaggcgcggggcgcgtatccggcttactctgcccgc
gtattccgcgaaaaaggggtaaccatcaacaaagcaccgggcgatgatgaaatcctgaaa
aacaccgtcgattttgtctcattcagctattacgcctcgcgctgcgcctcggcggagatg
aacgccaacaacagcagtgcggcgaatgtagtgaaatcgctgcgtaacccgtatctacag
gtaagcgactggggctggggtattgatccactcggtctgcgtatcaccatgaacatgatg
tacgaccgctatcagaagccgctgtttctggtggaaaacggcctcggcgcaaaagatgaa
tttgctgccaacggtgagattaacgatgactatcgcatcagctatttacgcgaacatatc
cgcgcaatgggcgaagcgattgcagatggcattccgctgatgggctacaccacctggggc
tgtattgatttggtttccgcctcaacgggtgaaatgagcaaacgctacggttttgtctat
gtagaccgtgacgatgcaggcaacggcacgctggcgcgcacgcgtaagaaatcgttctgg
tggtataaaaaagtgattgccagtaatggtgaggatttagagtaa

DBGET integrated database retrieval system