KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_3697Help
Entry
EcSMS35_3697      CDS       T00672                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ecm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3755507..3757591)
Genome map
AA seq 694 aa AA seqDB search
MESKRLDNAALAAGISPNYINAHGKPQSISAETKRRLLDAMHQRTATKVAVTPVPNVMVY
TSGKKMPMVVEGSGEYSWLLTTEEGTQYKGHVTGGKAFNLPTKLPEGYHTLTLTQDDQRA
HCRVIVAPKRCYEPQALLNKQKLWGACVQLYTLRSEKNWGIGDFGDLKAMLVDVAKRGGS
FIGLNPIHALYPANPESASPYSPSSRRWLNVIYIDVNAVEDFHLSEEALAWWKLPTTQQT
LQQARDADWVDYSTVTALKMTALRMAWKGFAQRDDEQVAAFRQFVAEQGDSLFWQAAFDA
LHAQQVKEDEMRWGWPAWPEMYQNVDSPEVRQFCEEHRDDVDFYLWLQWLAYSQFAACWE
ISQDYEMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMDP
HIITARAYEPFIELLRANMQNCGALRIDHVMSMLRLWWIPYGETADQGAYVHYPVDDLLS
ILALESKRHRCMVIGEDLGTVPVEIVGKLRSSGVYSYKVLYFENDHEKTFRSPKAYPEQS
MAVAATHDLPTLRGYWESGDLTLGKTLGLYPDEVVLRGLYQDRELAKQGLLDALHKYGCL
PKRAGHKASLMSMTPTLNRGLQRYIADSNSALLGLQPEDWLDMADPVNIPGTSYQYKNWR
RKLSATLEAMFADDGVNKLLKDLDRRRRAAAKKK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaacgtctggataatgccgcgctggcggcggggatcagccccaattacatc
aatgcccacggtaaaccgcagtcgattagcgccgaaaccaaacggcgtttgcttgacgcg
atgcatcaacgtaccgccacgaaagtggcggtaacgccagtcccgaatgtcatggtttat
accagcggcaaaaaaatgccgatggtggtggagggcagcggcgaatatagctggctgctg
accaccgaagaaggaacgcagtacaaaggccatgtaacggggggcaaagcgttcaatcta
ccgacgaagctgccggaaggttatcacacgctgacactcacccaggacgaccagcgtgct
cattgccgggtgattgtggcaccgaaacgctgttacgaaccgcaggcgttgctgaacaaa
caaaagctgtggggggcctgcgttcagctttatacgctgcgatcggaaaaaaactggggt
attggggattttggcgatctcaaagcgatgctggtggatgtggcaaaacgtggcgggtcg
ttcatcggtctgaacccgattcatgcgctctatccggcaaatccggaaagtgccagcccg
tatagcccgtcttctcgccgttggctgaatgtgatttatatcgacgttaacgccgttgaa
gatttccatcttagcgaagaggctctggcctggtggaagttgccgaccacgcaacagacg
ctgcaacaggcgcgggatgccgactgggtcgattactccacggttaccgccctaaaaatg
acagcattacgaatggcgtggaaaggtttcgcgcaacgtgatgatgaacaggtggccgcg
tttcgccagtttgttgcagagcaaggcgacagcctgttctggcaggcggcgtttgacgca
ctacatgcccagcaagtgaaagaggacgaaatgcgctggggctggcctgcatggccagag
atgtatcagaacgtggattcaccagaagtgcgccagttctgcgaagaacatcgtgatgac
gtcgatttttatctctggttgcagtggctggcttacagccagtttgccgcctgctgggag
ataagccaggactatgaaatgccgattggcttgtatcgtgatctggccgttggtgtagca
gaaggtggggcagaaacctggtgcgaccgtgaactgtattgcctgaaagcgtcggttggc
gcgccgccggatatcctcggcccgttggggcagaactggggattgccgccaatggacccg
catattatcaccgcgcgtgcctatgaaccgtttatcgagctgttgcgtgccaatatgcaa
aactgcggcgcattacgaattgaccatgtgatgtcgatgctgcgtttgtggtggataccg
tatggcgagacggcggatcagggggcatatgttcactatccagtggatgatctgctctcg
attctggcactcgaaagtaaacgtcatcgctgcatggtgattggtgaagatctcggtacc
gtaccggtagagattgtcggtaagctgcgcagcagcggtgtgtactcctacaaagtgctc
tatttcgaaaacgaccacgagaagacattccgctcaccgaaagcgtacccagagcagtcg
atggcggttgcggcgacacacgacctgcctacgctacgcggctactgggagagcggggat
ctaacgctgggcaaaacgctggggttgtatccggatgaagtggtactgcgcggtctgtat
caggatcgcgaactggcgaagcaaggactactggatgctctgcataaatatggttgtctg
ccaaaacgtgccgggcataaggcatcgttgatgtcgatgacgccgacgctgaatcgtggc
ttacagcgctacatcgccgatagcaacagcgccctgttaggactacagccagaagactgg
ctggatatggcggacccggtaaatattcccggcaccagttaccagtataaaaactggcgg
cgcaagctctccgcaacgcttgaggcgatgtttgccgatgatggcgtgaacaagttgctg
aaggatttggacagacggcgcagagcggcagcgaagaagaagtag

DBGET integrated database retrieval system