KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_4356Help
Entry
EcSMS35_4356      CDS       T00672                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00010  Glycolysis / Gluconeogenesis
ecm00030  Pentose phosphate pathway
ecm00051  Fructose and mannose metabolism
ecm00052  Galactose metabolism
ecm00680  Methane metabolism
ecm01100  Metabolic pathways
ecm01110  Biosynthesis of secondary metabolites
ecm01120  Microbial metabolism in diverse environments
ecm01130  Biosynthesis of antibiotics
ecm01200  Carbon metabolism
ecm01230  Biosynthesis of amino acids
ecm03018  RNA degradation
Module
ecm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcSMS35_4356 (pfkA)
   00030 Pentose phosphate pathway
    EcSMS35_4356 (pfkA)
   00051 Fructose and mannose metabolism
    EcSMS35_4356 (pfkA)
   00052 Galactose metabolism
    EcSMS35_4356 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    EcSMS35_4356 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EcSMS35_4356 (pfkA)
Enzymes [BR:ecm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EcSMS35_4356 (pfkA)
Protein phosphatases and associated proteins [BR:ecm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EcSMS35_4356 (pfkA)
Messenger RNA biogenesis [BR:ecm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     EcSMS35_4356 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ACB16769
UniProt: B1LNL9
Structure
PDB: 

Jmol
Position
4444980..4445942
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatcggtgtgttgacaagcggcggtgatgcgccaggcatgaacgccgca
attcgcggggttgttcgttctgcgctgacagaaggtctggaagtaatgggcatttatgac
ggctatctgggtctgtatgaagaccgtatggtacagctagaccgttacagcgtttctgac
atgatcaaccgtggcggtacgttcctcggttctgcgcgtttcccggaattccgcgacgag
aacatccgcgccgtggctatcgaaaacctgaaaaaacgtgggatcgatgcgctggtggtt
atcggcggtgacggttcctacatgggtgcaatgcgtctgaccgaaatgggcttcccgtgc
atcggcctgccgggcactatcgacaacgacatcaaaggcactgactacactatcggtttc
ttcactgcgctgagcaccgttgtagaagcgatcgaccgtctgcgtgacacctcttcttct
caccagcgtatttccgtggtggaagtgatgggtcgttattgtggcgatctgacgttggct
gcggctattgctggtggctgtgaattcgttgtagttccggaagttgaattcagccgtgaa
gacctggtaaacgaaatcaaagcgggtatcgcgaaaggtaaaaaacacgcgatcgtggcg
attaccgaacatatgtgtgatgttgacgaactggcgcatttcatcgagaaagaaaccggt
cgtgaaacccgcgcaactgtgctgggccacatccagcgcggtggttctccggtgccttac
gaccgtattctggcttcccgtatgggcgcttacgctatcgatctgctgctggcaggctac
ggcggtcgttgcgtaggtatccagaacgaacagctggttcaccacgacatcatcgacgct
atcgaaaacatgaagcgtccgttcaaaggcgactggctggactgcgcgaaaaaactgtat
taa

DBGET integrated database retrieval system