KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_4469Help
Entry
EcSMS35_4469      CDS       T00672                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ecm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ecm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
4562478..4563782
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLAASMYPDQSLYPANSVPAV
VERINNTFRRADQIQWSAGIEPGDPRYVDYFLPIVADAEAGFGGVLNAFELMKAMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVTGVPTLLVARTDADAADL
ITSDCDPYDSEFITGERTSEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLELARR
FAQAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKFQFITLAGIHSMWF
NMFDLANAYAQGEGMKHYVEKVQQPEFAAAKDGYTFVSHQQEVGTGYFDKVTTIIQGGTS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaattgaagaattacagaaagagtggactcaaccgcgttgg
gaaggcattactcggccatacagcgcggaagatgtggtgaaattacgcggttcagtcaat
cctgaatgcacgctggcgcaactgggcgcggcgaaaatgtggcgtctgctgcacggcgag
tcgaaaaaaggctacatcaacagcctcggtgcactgactggcggtcaggcgctgcaacag
gcgaaagcgggtattgaagcggtctatctgtcgggatggcaggtagcggcggacgctaac
ctggcggccagcatgtatccggatcagtcgctctatccggcaaactcggtgccagctgtg
gtggagcggatcaacaacaccttccgccgtgcggatcagatccaatggtccgcgggcatt
gagccgggcgatccgcgctatgtcgattacttcctgccgatcgttgctgatgcggaagcc
ggttttggcggtgtcctgaatgcctttgaactgatgaaagcgatgattgaagccggtgca
gcggcagttcacttcgaagatcagctggcatcagtgaagaaatgcggtcacatgggcggc
aaagttttagtgccaactcaggaagctattcagaaactggtcgcggcgcgtctggcagct
gacgtgacgggcgttccaacccttctggttgcccgtaccgatgctgatgcggcggatctg
attacctccgattgcgacccgtatgacagcgaatttattaccggcgagcgtaccagtgaa
ggcttcttccgtactcatgcaggtattgaacaagcgatcagccgtggcctggcgtatgcg
ccatatgctgacctggtatggtgtgaaacctccacgccggatctggaactggcgcgtcgc
tttgcacaagccatccacgcgaaatatccgggcaaactgctggcttataactgctcgcct
tcgttcaactggcagaaaaacctcgacgacaaaactattgccagcttccagcagcagctg
tcggatatgggctacaagttccagttcatcaccctggcaggtatccacagcatgtggttc
aacatgtttgacctggcaaacgcctatgcccagggcgagggtatgaagcactatgttgag
aaagtgcagcagccggaatttgccgccgcgaaagatggctataccttcgtatctcaccag
caggaagtgggtacaggttacttcgataaagtgacgaccattattcagggcggcacgtcg
tcggttaccgcactgactggctccactgaagaatcgcagttctaa

DBGET integrated database retrieval system