KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_4531Help
Entry
EcSMS35_4531      CDS       T00672                                 

Gene name
acsA
Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
ecm00010  Glycolysis / Gluconeogenesis
ecm00620  Pyruvate metabolism
ecm00640  Propanoate metabolism
ecm00680  Methane metabolism
ecm01100  Metabolic pathways
ecm01110  Biosynthesis of secondary metabolites
ecm01120  Microbial metabolism in diverse environments
ecm01130  Biosynthesis of antibiotics
ecm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EcSMS35_4531 (acsA)
   00620 Pyruvate metabolism
    EcSMS35_4531 (acsA)
   00640 Propanoate metabolism
    EcSMS35_4531 (acsA)
  Energy metabolism
   00680 Methane metabolism
    EcSMS35_4531 (acsA)
Enzymes [BR:ecm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     EcSMS35_4531 (acsA)
Lipid biosynthesis proteins [BR:ecm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   EcSMS35_4531 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACB19762
UniProt: B1LPN4
Position
complement(4631470..4633428)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHTIPANIADRCLINPQQYEAMYQQSINAPDTFWGEQGKILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLQENGDRTAIIWEGDDASQSKHISYKELHRDVCRF
ANTLLELGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITSDEGVRAGRSIPLKKNVDDALKNPNVTSVEHVVVLKRTGGKIDWQEGRDLWWHDL
VEQASDQHQAEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMAQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGHPLEGAAEGSLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaattcacaaacacaccattcctgccaacatcgcagaccgttgcctgataaac
cctcagcagtacgaggcgatgtatcaacaatctattaacgcaccagataccttctggggc
gaacagggaaaaattctcgactggatcaaaccttaccagaaggtgaaaaacacctccttt
gcccccggtaatgtgtccattaaatggtacgaggacggcacgctgaatctggcggcaaac
tgccttgaccgccatctgcaagaaaacggcgatcgtaccgccatcatctgggaaggcgac
gacgccagccagagcaaacatatcagctataaagagctgcaccgcgacgtctgccgcttc
gccaataccctgctcgagctgggcattaaaaaaggtgatgtggtggcgatttatatgccg
atggtgccggaagccgcggtcgcgatgctggcctgcgcccgcattggcgcggtgcattcg
gtaattttcggcggcttctcgccggaagccgttgccgggcgcattatcgattctaactca
cggttggtgatcacttccgacgaaggcgtgcgcgccgggcgtagtattccgctgaagaaa
aacgttgatgacgcgctgaaaaacccgaacgtcaccagcgtagagcatgtggtggtactg
aagcgtactggcggaaaaattgactggcaggaagggcgcgacctgtggtggcacgacctg
gttgagcaagcgagcgatcagcaccaggcggaagagatgaacgccgaagatccgctgttt
attctctatacctccggttctaccggtaagccgaaaggcgtactgcacactaccggcggt
tatctggtgtacgcggcgctgacctttaaatatgtctttgattatcatccgggcgatatc
tactggtgcaccgccgatgtgggttgggttaccggacacagttatttgctgtacggcccg
ttggcctgcggcgcgaccacgctgatgtttgaaggcgtaccgaactggccgacgcctgcc
cgtatggcgcaggtggtggacaagcatcaggtcaatattctctataccgcgcccacggcg
attcgcgcgctgatggcggaaggcgataaagcgattgaaggcaccgatcgatcgtcgctg
cgcattctcggttccgtgggcgagccaatcaacccggaagcgtgggagtggtactggaag
aagatcggcaacgagaaatgcccagtggtcgatacctggtggcagaccgaaactggcggt
ttcatgatcaccccactgcctggcgctaccgagctgaaagccggttcggcaacacgtccg
ttcttcggcgtacaaccggcgctggtcgataacgaaggtcatccgctggagggggccgcc
gaaggcagtctggtgatcaccgactcctggcctggtcaggcgcgtacattgtttggcgat
cacgaacgctttgaacagacctacttctccaccttcaaaaatatgtatttcagcggcgac
ggcgcgcgtcgtgatgaagatggctattactggatcaccgggcgcgtggacgacgtgctg
aacgtctcgggtcaccgtctgggaacagcggagattgagtcggcgctggtggcgcatccg
aagattgccgaagccgctgtcgtcggtattccgcacaatattaaaggtcaggcgatctac
gcctacgtcacgcttaatcacggggaggaaccgtcaccagaactgtacgcagaagtccgc
aactgggtgcgtaaagagattggcccgctggcgacgccagacgtgctgcactggaccgac
tccctgcctaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcg
ggcgataccagcaacctgggcgatacctcgacgcttgccgatcctggcgtagtcgagaag
ctgcttgaagagaagcaggctatcgcgatgccatcgtaa

DBGET integrated database retrieval system