KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_A0072Help
Entry
EcSMS35_A0072     CDS       T00672                                 

Gene name
sopB
Definition
(RefSeq) plasmid-partitioning protein
  KO
K03497  
chromosome partitioning protein, ParB family
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Brite
Transcription factors [BR:ecm03000]
 Prokaryotic Type
  Other transcription factors
   Others
    EcSMS35_A0072 (sopB)
Chromosome [BR:ecm03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    EcSMS35_A0072 (sopB)
Cytoskeleton proteins [BR:ecm04812]
 Prokaryotic cytoskeleton proteins
  MinD / ParA class of bacterial cytoskeletal proteins
   EcSMS35_A0072 (sopB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSMS35_130:complement(53664..54635)
Genome map
AA seq 323 aa AA seqDB search
MKRAPVIPKHTIKTQPLEDTPSSAPAAPMVDSLIARVGAMARGNAITLPVCGRDVKFTLE
VLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTPAFGRRVSGVIEIADGS
RRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYERGQRYASRLQNEFAGNIS
ALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQRAFTDKEELLKQQAS
NLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLSSRHQFAPGATVLYKGDKMVLNLDR
SRIPTECIERIEAILKELEKAAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgcgcctgtcattccaaaacatacgattaagactcaaccgcttgaagatact
ccgtcatcggcaccagctgcaccgatggtggattcgttaattgcgcgcgtaggagctatg
gctcgtggcaatgctattactttgcctgtatgtggtagggacgtgaaatttacccttgag
gtgctccggggagatagtgttgagaagacctctcgggtatggtcaggtaatgaacgtgac
caggaactgcttaccgaagacgccctggatgatcttatcccttcttttctactgacaggt
cagcagacaccagcattcggtcgaagagtgtctggggtcatagaaattgccgatgggagc
cgccgtcgtaaagctgctgcacttacagaaagtgattatcgagttctggttggtgagctg
gatgatgagcagatggctgcattgtccagattgggtaacgattataggccaacaagtgct
tatgaacgtggtcagcgttatgcaagccgattgcagaatgaatttgctggaaatatttct
gcgctggctgatgcagaaaatatttcacgtaagattattacccgctgtatcaacacagct
aaactgcctaaatcagttgttgctcttttttctcatcccggtgaactatctgcccggtca
ggtgatgcacttcaaagagcttttacagataaagaagaattacttaagcagcaggcatct
aaccttcacgagcagaaaaaagcaggagtgatatttgaagctgaagaagtcatcactctt
ttaacgtctgtgcttaaaacgtcatctgcctcaagaactagcttaagctcacgacatcag
tttgctcctggagcgacagtgttgtacaagggcgataaaatggtgttaaacctagataga
tctcgtattccaactgagtgtatagagagaattgaagccattcttaaggaacttgaaaaa
gcggcactttga

DBGET integrated database retrieval system