KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_A0072Help
Entry
EcSMS35_A0072     CDS       T00672                                 

Gene name
sopB
Definition
plasmid-partitioning protein
Orthology
K03497  
chromosome partitioning protein, ParB family
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSMS35_130:complement(53664..54635)
Genome map
AA seq 323 aa AA seqDB search
MKRAPVIPKHTIKTQPLEDTPSSAPAAPMVDSLIARVGAMARGNAITLPVCGRDVKFTLE
VLRGDSVEKTSRVWSGNERDQELLTEDALDDLIPSFLLTGQQTPAFGRRVSGVIEIADGS
RRRKAAALTESDYRVLVGELDDEQMAALSRLGNDYRPTSAYERGQRYASRLQNEFAGNIS
ALADAENISRKIITRCINTAKLPKSVVALFSHPGELSARSGDALQRAFTDKEELLKQQAS
NLHEQKKAGVIFEAEEVITLLTSVLKTSSASRTSLSSRHQFAPGATVLYKGDKMVLNLDR
SRIPTECIERIEAILKELEKAAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtgcgcctgtcattccaaaacatacgattaagactcaaccgcttgaagatact
ccgtcatcggcaccagctgcaccgatggtggattcgttaattgcgcgcgtaggagctatg
gctcgtggcaatgctattactttgcctgtatgtggtagggacgtgaaatttacccttgag
gtgctccggggagatagtgttgagaagacctctcgggtatggtcaggtaatgaacgtgac
caggaactgcttaccgaagacgccctggatgatcttatcccttcttttctactgacaggt
cagcagacaccagcattcggtcgaagagtgtctggggtcatagaaattgccgatgggagc
cgccgtcgtaaagctgctgcacttacagaaagtgattatcgagttctggttggtgagctg
gatgatgagcagatggctgcattgtccagattgggtaacgattataggccaacaagtgct
tatgaacgtggtcagcgttatgcaagccgattgcagaatgaatttgctggaaatatttct
gcgctggctgatgcagaaaatatttcacgtaagattattacccgctgtatcaacacagct
aaactgcctaaatcagttgttgctcttttttctcatcccggtgaactatctgcccggtca
ggtgatgcacttcaaagagcttttacagataaagaagaattacttaagcagcaggcatct
aaccttcacgagcagaaaaaagcaggagtgatatttgaagctgaagaagtcatcactctt
ttaacgtctgtgcttaaaacgtcatctgcctcaagaactagcttaagctcacgacatcag
tttgctcctggagcgacagtgttgtacaagggcgataaaatggtgttaaacctagataga
tctcgtattccaactgagtgtatagagagaattgaagccattcttaaggaacttgaaaaa
gcggcactttga

DBGET integrated database retrieval system