KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_A0121Help
Entry
EcSMS35_A0121     CDS       T00672                                 

Gene name
dhfrV
Definition
dihydrofolate reductase type 5 (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ecm00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ecm00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSMS35_130:91389..91871
Genome map
AA seq 160 aa AA seqDB search
MRTLKVSLMAAKAKNGVIGCGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNR
KYAVVTRSGWTSNDDNVVVFQSIEEAMDRLAEFTGHVIVSGGGEIYRETLPMASTLHLST
IDIEPEGDVFFPSIPNTFEVVFEQHFTSNINYCYQIWKKG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccttgaaagtatcattgatggctgcgaaagcgaaaaacggcgtgattggttgc
ggtccagacataccctggtccgcgaaaggggagcagctactttttaaagcattgacctac
aatcagtggcttctggtgggtcgcaagacgtttgaatctatgggcgcactccccaatagg
aaatacgcggtcgttacccgctcaggttggacatcaaatgatgacaatgtagttgtattt
cagtcaatcgaagaggccatggacaggctagctgaattcaccggtcacgttatagtgtct
ggtggcggagaaatttaccgagaaacattacccatggcctctacgctccacttatcgacg
atcgacatcgagccagagggggatgttttcttcccgagtattccaaataccttcgaagtt
gtttttgagcaacactttacttcaaacattaactattgctatcaaatttggaaaaagggt
taa

DBGET integrated database retrieval system