KEGG   Escherichia coli SMS-3-5 (environmental): EcSMS35_A0121Help
Entry
EcSMS35_A0121     CDS       T00672                                 

Gene name
dhfrV
Definition
dihydrofolate reductase type 5 (EC:1.5.1.3)
Orthology
K18589  
dihydrofolate reductase (trimethoprim resistance protein) [EC:1.5.1.3]
Organism
ecm  Escherichia coli SMS-3-5 (environmental)
Pathway
One carbon pool by folate
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:ecm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EcSMS35_A0121 (dhfrV)
   00670 One carbon pool by folate
    EcSMS35_A0121 (dhfrV)
Enzymes [BR:ecm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     EcSMS35_A0121 (dhfrV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pSMS35_130:91389..91871
Genome map
AA seq 160 aa AA seqDB search
MRTLKVSLMAAKAKNGVIGCGPDIPWSAKGEQLLFKALTYNQWLLVGRKTFESMGALPNR
KYAVVTRSGWTSNDDNVVVFQSIEEAMDRLAEFTGHVIVSGGGEIYRETLPMASTLHLST
IDIEPEGDVFFPSIPNTFEVVFEQHFTSNINYCYQIWKKG
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccttgaaagtatcattgatggctgcgaaagcgaaaaacggcgtgattggttgc
ggtccagacataccctggtccgcgaaaggggagcagctactttttaaagcattgacctac
aatcagtggcttctggtgggtcgcaagacgtttgaatctatgggcgcactccccaatagg
aaatacgcggtcgttacccgctcaggttggacatcaaatgatgacaatgtagttgtattt
cagtcaatcgaagaggccatggacaggctagctgaattcaccggtcacgttatagtgtct
ggtggcggagaaatttaccgagaaacattacccatggcctctacgctccacttatcgacg
atcgacatcgagccagagggggatgttttcttcccgagtattccaaataccttcgaagtt
gtttttgagcaacactttacttcaaacattaactattgctatcaaatttggaaaaagggt
taa

DBGET integrated database retrieval system