KEGG   Ehrlichia canis: Ecaj_0190Help
Entry
Ecaj_0190         CDS       T00270                                 

Definition
succinate dehydrogenase subunit D (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ecn  Ehrlichia canis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ecaj_0190
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ecaj_0190
   00650 Butanoate metabolism
    Ecaj_0190
  Energy metabolism
   00190 Oxidative phosphorylation
    Ecaj_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
288016..288372
Genome map
AA seq 118 aa AA seqDB search
MVSHSVYHWLIQRATAFVLLPLSMWFLFKFVAVVSLIFKSLPDLHLCFSSIGITDLVVLL
CFFVFAFYHGVLGIQVILEDYIHSSILRTSVFLVIKVIVVLTVLFLVFIVLYNTLFMY
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcattcagtttatcattggttgattcaaagggctacagcttttgttttactt
cctctttccatgtggtttttgtttaagtttgttgctgttgtttctttaatatttaagtct
ttgccagatcttcatttatgtttttctagtataggtataactgaccttgttgttttatta
tgcttttttgtttttgcgttttatcatggagttttaggtatacaagttatattagaagac
tatatacattcttctatattaaggacatcggtatttcttgttattaaagtgattgtagtt
ttaacagtattgtttttggtgtttatagttttgtataatacgttatttatgtattaa

DBGET integrated database retrieval system