KEGG   Ehrlichia canis: Ecaj_0190Help
Entry
Ecaj_0190         CDS       T00270                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ecn  Ehrlichia canis
Pathway
ecn00020  Citrate cycle (TCA cycle)
ecn00190  Oxidative phosphorylation
ecn00650  Butanoate metabolism
ecn01100  Metabolic pathways
ecn01110  Biosynthesis of secondary metabolites
ecn01120  Microbial metabolism in diverse environments
ecn01130  Biosynthesis of antibiotics
ecn01200  Carbon metabolism
Module
ecn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ecn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ecn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ecaj_0190
   00650 Butanoate metabolism
    Ecaj_0190
  Energy metabolism
   00190 Oxidative phosphorylation
    Ecaj_0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AAZ68241
JGI: Eca0190
UniProt: Q3YSR4
Position
288016..288372
Genome map
AA seq 118 aa AA seqDB search
MVSHSVYHWLIQRATAFVLLPLSMWFLFKFVAVVSLIFKSLPDLHLCFSSIGITDLVVLL
CFFVFAFYHGVLGIQVILEDYIHSSILRTSVFLVIKVIVVLTVLFLVFIVLYNTLFMY
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggttagtcattcagtttatcattggttgattcaaagggctacagcttttgttttactt
cctctttccatgtggtttttgtttaagtttgttgctgttgtttctttaatatttaagtct
ttgccagatcttcatttatgtttttctagtataggtataactgaccttgttgttttatta
tgcttttttgtttttgcgttttatcatggagttttaggtatacaagttatattagaagac
tatatacattcttctatattaaggacatcggtatttcttgttattaaagtgattgtagtt
ttaacagtattgtttttggtgtttatagttttgtataatacgttatttatgtattaa

DBGET integrated database retrieval system