KEGG   Ehrlichia canis: Ecaj_0245Help
Entry
Ecaj_0245         CDS       T00270                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ecn  Ehrlichia canis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ecn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
369630..370217
Genome map
AA seq 195 aa AA seqDB search
MDINKLINMFAKLPNFGPSSSRRIVLHLLRNKEEVMLPLASGIQDLAFQTKECSVCFNID
VKSPCSICSDTKRDHQLLCIVEELGDLWAFEKGKIYQGVYHVLGGTLSAIYGIGPDQLNL
DNIVERIKKFDIKEVIIGIGNTMDGQVTTHYITQIVKGLGIKITRLACGIPMGGEIDYLD
EGTLSAALSSRYVIS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtggatattaataaattgattaatatgtttgcaaaattacctaattttggaccatcttct
tccagaaggattgtgctgcatttacttcggaataaagaggaggtaatgttgcctttagct
tctggaattcaggatttagcatttcagactaaggagtgttctgtatgcttcaatatagat
gtaaaatcaccgtgtagtatctgttctgatactaaacgtgatcatcagttattatgtata
gtagaagagctgggagatttatgggcatttgagaaaggaaaaatatatcaaggagtatac
catgtgttaggagggactttatctgcaatttatggtataggacctgatcaattgaactta
gataatattgtagaaagaataaaaaagtttgacataaaagaagtaataataggtataggt
aataccatggatgggcaggtaactactcattatataactcagatagttaagggattaggt
attaagataactaggttagcctgtggtatacctatgggtggagaaatagattatttagat
gaaggcactttaagtgcagctttgtcttctcgttatgttatatcttag

DBGET integrated database retrieval system