KEGG   Ehrlichia canis: Ecaj_0245Help
Entry
Ecaj_0245         CDS       T00270                                 

Definition
(GenBank) RecR protein
  KO
K06187  
recombination protein RecR
Organism
ecn  Ehrlichia canis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Ecaj_0245
DNA repair and recombination proteins [BR:ecn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Ecaj_0245
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Ecaj_0245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
369630..370217
Genome map
AA seq 195 aa AA seqDB search
MDINKLINMFAKLPNFGPSSSRRIVLHLLRNKEEVMLPLASGIQDLAFQTKECSVCFNID
VKSPCSICSDTKRDHQLLCIVEELGDLWAFEKGKIYQGVYHVLGGTLSAIYGIGPDQLNL
DNIVERIKKFDIKEVIIGIGNTMDGQVTTHYITQIVKGLGIKITRLACGIPMGGEIDYLD
EGTLSAALSSRYVIS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtggatattaataaattgattaatatgtttgcaaaattacctaattttggaccatcttct
tccagaaggattgtgctgcatttacttcggaataaagaggaggtaatgttgcctttagct
tctggaattcaggatttagcatttcagactaaggagtgttctgtatgcttcaatatagat
gtaaaatcaccgtgtagtatctgttctgatactaaacgtgatcatcagttattatgtata
gtagaagagctgggagatttatgggcatttgagaaaggaaaaatatatcaaggagtatac
catgtgttaggagggactttatctgcaatttatggtataggacctgatcaattgaactta
gataatattgtagaaagaataaaaaagtttgacataaaagaagtaataataggtataggt
aataccatggatgggcaggtaactactcattatataactcagatagttaagggattaggt
attaagataactaggttagcctgtggtatacctatgggtggagaaatagattatttagat
gaaggcactttaagtgcagctttgtcttctcgttatgttatatcttag

DBGET integrated database retrieval system