KEGG   Ehrlichia canis: Ecaj_0267Help
Entry
Ecaj_0267         CDS       T00270                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
ecn  Ehrlichia canis
Pathway
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ecn00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
408264..409640
Genome map
AA seq 458 aa AA seqDB search
MDNSLPVIRSKTINSVFKVMGEMADAIFSWVGSINKDLTRDQDISNLYEKMKECVNPKGG
EIKARYNTISLGNLYLNLSDVGKIAFFKLLEGKFSADRIAIDEKIGDYIRETDENKKRKC
EFELMTVLESPRFHILKQFISLPDGLKFIVDMRADVMRLKDKCQLFFSLEKDLRHILSTW
FDVGLLDLHQITWDSPASLLEKLILYEAVHAISSWDDLRDRLDSDRRCFAFFHYKMSVEP
LIFVEVALVDEMATSIQMLLDSHVPPKDPKNAKVAIFYSISNTQRGLSGISLGNFLIKRV
VNKLSEEFQHIKIYATLSPIPGFVRWLTKTLPDNLELLNDLKVNISIDDIISYVNNKQYA
DLTQDIKSLFLKLCAYYLVKAKSVDRALDPVAHFHLSNGAIIKQLNWMADISEKGLSSSM
GIMVNYHYELSKIDDNYENYVINKEINCSKEVLSLLKR
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggataattcattaccggtaataaggagcaaaacaataaacagtgtttttaaagtcatg
ggtgaaatggctgatgcaatattttcttgggttggtagtattaataaggatttaaccagg
gatcaagatattagcaatctttatgagaaaatgaaagaatgtgttaatccaaagggtggg
gaaattaaagcaaggtataatactatatctcttggtaatttatatttgaacttatctgat
gttggtaaaatagcgttttttaaattgttagaaggaaaatttagtgctgatagaattgcg
atagatgaaaagataggtgattatatacgtgagacagatgaaaataagaaaagaaaatgt
gaatttgaattgatgacagttttggaatctcccagatttcatatacttaaacaatttatt
tcattacctgatggtttaaagtttattgttgacatgagagctgatgtaatgcgcttgaag
gataaatgtcaattgtttttttctctagaaaaagatttaaggcatatattatctacttgg
tttgatgttggacttctggatttgcatcaaattacatgggattcccctgcttctttattg
gaaaagttgattttatatgaagcagttcatgcaatttcttcatgggatgacttacgagat
agattagattcagatcggagatgctttgcttttttccactataaaatgtcagttgaacct
ttaatttttgtggaggtagctcttgttgatgaaatggctactagtatacaaatgttatta
gattctcatgttccacctaaagatccgaagaatgcaaaagttgctattttttattctatt
tcaaatacacagagagggctttctggaataagcttaggtaactttttaataaaacgtgtt
gttaataaattgtcagaagagtttcaacatattaaaatttatgcaactctttctccgata
cctgggtttgttagatggcttacaaaaactttaccagataatcttgaattactaaatgat
cttaaagttaatatatctattgatgatataatatcatatgtgaataataagcagtatgct
gatttgactcaggatattaaaagtttgtttctaaaattatgtgcttattatttagtaaaa
gctaaaagtgttgatagagcattagatccagtagcacattttcatttaagtaatggtgcg
attatcaagcaattaaactggatggctgatatttctgaaaagggtttgagtagttcaatg
ggtattatggtaaattatcattatgaattatctaaaatagatgataattatgaaaactat
gtcattaataaagagattaattgttcaaaagaagtattgtcactattaaagcgttga

DBGET integrated database retrieval system