KEGG   Ehrlichia canis: Ecaj_0317Help
Entry
Ecaj_0317         CDS       T00270                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ecn  Ehrlichia canis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ecn00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
477954..478802
Genome map
AA seq 282 aa AA seqDB search
MSIFLVKAPAKVNLFLHITGKRIDQHHYLESLFVFVNVYDLLEVNIDGRKRGVYFSNFKI
SKYNNTVYKAIELLLKHSSVRPNISVNVIKNILVSAGLAGGSADAAAIIRLLGNMWNIDC
KLLQDLALKVGSDVPACLESKTLFAKGVGEDILLLPDLLLPRYIILVAPRGKSLSTAKVF
NHYKCDNFSASICDKLPVKQDDWMELIYNSKNDLLDVALNFVPEIEEILFVLKKLKNVFI
ARMTGSGATCFALFHELSHAENAAKHLRMTRPDWVIFNAKIL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatatttttagtgaaagcaccagcaaaagttaatttatttttgcatattactggt
aaacgcattgatcaacatcattatttggaatccttatttgtttttgttaacgtttatgat
cttttagaagttaatattgatgggagaaagaggggagtatatttttcaaattttaagatt
agtaaatataataatactgtgtataaggcaatagaattgttgttaaagcacagttctgta
cgtccaaatatttctgtaaatgtgataaaaaatattttagtttctgcaggattagcaggt
gggtcagctgacgctgctgccatcatacgtttattaggtaatatgtggaatattgattgt
aaattgctacaagatttagcgttaaaagttgggagtgatgttccagcatgtttagaatct
aaaacgctttttgctaaaggagttggagaagatatactgttgttacctgatttattattg
ccgagatacattatacttgttgcaccgagaggtaagtcattaagtacagcaaaagtcttt
aatcattataagtgtgataatttctctgcttcaatatgtgataaacttcctgttaaacaa
gatgattggatggaattgatttataattctaagaatgatttactagatgtagcattgaat
tttgttccagaaatagaagaaatattatttgtattaaagaaattaaaaaatgtttttatt
gcacgtatgactggcagtggtgctacgtgttttgcattgtttcatgagttaagtcatgct
gagaatgcagctaagcacttgcggatgacacgtcctgattgggtaatatttaatgctaaa
atactttaa

DBGET integrated database retrieval system