KEGG   Ehrlichia canis: Ecaj_0393Help
Entry
Ecaj_0393         CDS       T00270                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ecn  Ehrlichia canis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ecaj_0393
   01230 Biosynthesis of amino acids
    Ecaj_0393
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Ecaj_0393
   00051 Fructose and mannose metabolism
    Ecaj_0393
   00562 Inositol phosphate metabolism
    Ecaj_0393
Enzymes [BR:ecn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Ecaj_0393
Exosome [BR:ecn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Ecaj_0393
  Exosomal proteins of bladder cancer cells
   Ecaj_0393
  Exosomal proteins of melanoma cells
   Ecaj_0393
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
592096..592863
Genome map
AA seq 255 aa AA seqDB search
MSSSLIAGTLFLVIFMSLLIVANWKMYGDFITFSSFTKELSINLTNVKADLEVVLCPPFI
ALPKVVDCISCIKFGAQNCFYETEGKYTGEVSAKMLYDCGCSYVIVGHSERRSIFHESDY
HVQLKASAAIKSGLIPIVCVGETLLDRENGMLKDSLLNQCYNSFPKSGKFIIAYEPVWAI
GSNTIPSIDMITEALEVIRSYDSTSDIIYGGAVNQDNIRDVIAINQLSGVLVGSASLKLD
SFYNIIHGAVNVRQN
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaagtcttatagccggcacgttatttttagtaatttttatgtcattgctcatc
gttgctaattggaagatgtatggtgactttattaccttttcctcttttacaaaggaatta
agtattaatttaactaatgtaaaggctgatttagaggtagtgttatgtccaccttttatt
gcactacctaaagtggttgattgtatttcttgtattaagtttggtgcacagaattgcttt
tatgaaactgaaggaaaatatactggtgaagttagtgcgaaaatgttatatgattgtgga
tgtagttatgtaatagttggtcattctgaaagaagaagcatatttcatgaatctgattac
catgtacagttgaaagcaagtgctgctattaaatctgggttgataccaattgtttgtgtt
ggagaaactttattagatagagaaaatggtatgctaaaagactcattattaaatcaatgt
tataattcttttcctaaaagtggtaaatttattatagcttatgagcctgtgtgggcaata
gggagtaatactataccttctattgatatgataactgaagctttagaggttattaggtca
tacgatagtacatctgacattatatatggtggtgcagtaaatcaagataatataagagat
gttattgctataaatcaattatctggtgtattggttggtagtgcaagtttaaaattagat
agtttttataatataatacatggtgctgtaaatgtgaggcaaaactaa

DBGET integrated database retrieval system