KEGG   Ehrlichia canis: Ecaj_0418Help
Entry
Ecaj_0418         CDS       T00270                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ecn  Ehrlichia canis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ecn00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ecn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
621197..622114
Genome map
AA seq 305 aa AA seqDB search
MNTLLEISSLTPDDIESIFNITMQYFNNRSQNNKILNGKVVVNLFFESSTRTLSSFEIAE
KSLGAHSITLNINTSSINKGESIIDTILNINAMNPDLIIIRSQYSQLVKTISQYVSNCCI
INAGDGNHEHPTQALIDYCTIRYLKKNISNLNISICGDILHSRVARSNIRLLSRYGANIS
LIAPPTLACDLVGVSHIYHNLIDGIRDADVIMLLRLQKERITNCVIPSEEEYSHLYMLNS
ERLSYAKKDVIIMHPGPTNKGTEISNNVAENKSVILLQVKMGVAVRKAILHYLLYGNKCN
TSNEI
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgaatacattactagagataagtagcctaacacctgatgacatagaatccatttttaac
attacaatgcaatactttaataataggagtcagaataataagattttaaatggaaaagtt
gttgttaatttattttttgaaagctcaacacgtactttgtcttcttttgagattgcagaa
aagtcattaggtgcacattctataacgttaaacattaatacctcatctataaataaagga
gaaagcattatagatacgattttaaatataaatgcaatgaatcctgatttaattataata
aggtcacaatatagtcaattagtcaaaacaatatctcagtatgtatcaaattgttgtata
ataaatgctggagatgggaatcatgaacatccaacacaggcattaatagattattgtact
atacgctatctaaaaaaaaatattagtaatttaaatatatccatatgcggagatatatta
catagtagagttgcaagatcaaatataaggttattatctaggtacggagccaatatatct
ctaattgctcctccaacattagcgtgtgacttggttggtgtatcgcatatatatcataac
ttgattgatggaatacgtgatgcagatgtcattatgttattaagattacaaaaagaacgt
ataactaattgtgttattccttcagaagaggagtattcacatctatatatgctgaattct
gagaggctatcttatgcaaaaaaagatgtaataattatgcacccaggtcctacaaacaaa
ggaactgaaatttctaataatgtagcagaaaataagtctgtgattctactacaagtaaaa
atgggtgttgcagtacgtaaagctatattacattatttattatacggtaataaatgtaat
accagtaatgagatataa

DBGET integrated database retrieval system