KEGG   Ehrlichia canis: Ecaj_0473Help
Entry
Ecaj_0473         CDS       T00270                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ecn  Ehrlichia canis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ecn00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(692522..693685)
Genome map
AA seq 387 aa AA seqDB search
MKTVSVFGSTGAIGQMIIDIIFSELDKYQVKVLVAKSNIQLLAFQAKLVNAERVVITDVN
LYRELKDLLLDTNIKVSAGDDGMIMATSLDVDYAMMAIVGIAALVPMTYLINSNVKVIAL
ANKESIVCGGALLLSLAKEKDVKIIPLDSEHNAIYQILADKGHKDLEKITLTASGGPLLS
MDYEQMKYVTVQDTVKHPVWKMGKKISVDSATMINKSLEIIEAYYLFSIKAEKLDVIIHN
ESVVHGIISYIDGTSIAFMSVPDMKIPIMYSLSWPNRSAALCKKLNLALYNQLTFMKPDI
YKFPGIKLGFEVLKTSNVHANGIILNAANEIAVNAFLAKKIGFLDIVNIVYETLNLVNYG
RINSLSNILDCDAISRKVASSTIDKLC
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacagtttctgtatttggctctactggtgctattggccaaatgataattgatata
atattttctgagttagataagtatcaagtaaaagtattagttgctaagtcaaatattcag
ctgttagcatttcaagctaaattggttaatgcagaaagagttgttattactgatgttaat
ttatatcgagaattaaaagacttattgctcgatacaaatattaaagtgagtgctggagat
gacggcatgattatggctacgtctttagatgtagattatgcaatgatggctattgtaggg
atagcagcacttgtgccgatgacttatttaataaattcaaatgttaaagttattgcacta
gcgaataaagagagtatagtttgtggtggtgcattattacttagtttagcaaaagaaaag
gatgttaaaattattcctctagattcagaacataatgctatataccaaatacttgctgac
aagggccataaagatttagaaaaaattacattaaccgcgtctggtggacctttattatca
atggattatgaacaaatgaaatatgtaactgttcaagatacagttaagcaccctgtttgg
aaaatgggtaaaaaaatatctgttgatagtgcaactatgattaataaatctcttgagatt
atagaagcatattatttattttcaataaaagctgaaaaattagatgtaataatacataac
gaatctgtagtgcatgggataatatcttatatagatggaacatctattgcttttatgtct
gtaccagatatgaaaattccaattatgtattcattatcttggccgaatagatcagctgct
ttgtgtaaaaaactgaatttagcgttatataatcaattaacttttatgaaacctgatatt
tataagtttcctggcataaaattaggttttgaagttttaaaaacatctaatgttcatgct
aatggtattattttaaatgctgcaaatgaaattgctgttaatgcttttttggctaagaag
atagggtttcttgatattgtaaatatagtgtatgaaacattaaatttagttaattatgga
cgtattaattctttgtcaaatattcttgattgtgatgcaataagtaggaaagtagcaagt
agtactattgataaattgtgttaa

DBGET integrated database retrieval system