KEGG   Ehrlichia canis: Ecaj_0546Help
Entry
Ecaj_0546         CDS       T00270                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ecn  Ehrlichia canis
Pathway
ecn00860  Porphyrin and chlorophyll metabolism
ecn01100  Metabolic pathways
ecn01110  Biosynthesis of secondary metabolites
ecn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ecaj_0546
Enzymes [BR:ecn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Ecaj_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 PTS_IIB
Motif
Other DBs
NCBI-ProteinID: AAZ68581
JGI: Eca0546
UniProt: Q3YRS4
Position
797937..798659
Genome map
AA seq 240 aa AA seqDB search
MQFYYMKSLLVTRPEKDSIKIKESLNKLGFNVYIEPMFSIKYLTAKITLKDFDLIICTSQ
HSIIALSKITKNRDITIITVGNNTMHIAQELGFTFVKSLNGNINDVVSYLQNYSKSNILY
IRGKEVTYNLKKTFNHYKNFQEIILYNTIDRTHFSKCCYSAFLGNKISGVLLYSSRTAEI
LIELIKKYNIQDKISNITAYTMSNKIANTAKNVHWKTIKISDQPTNESLLSLISNNIRNI
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcaattttattatatgaaatctttattagttactcgtccagaaaaagactctatcaaa
attaaggaatctctcaataaattagggttcaatgtgtatatcgagccaatgttttcaata
aaatatttaacagctaaaataacactaaaagattttgatttgataatatgtacaagtcag
catagcataattgctttaagtaaaatcaccaaaaacagggatataactatcatcacagtc
ggtaataacactatgcacattgcacaagaattagggtttacatttgtaaaatcacttaat
ggcaatattaacgatgttgtttcttatctacaaaattatagcaaatctaatattttatac
ataagagggaaagaagtaacatacaatctcaaaaaaacttttaaccattacaaaaacttt
caagaaattatactatacaatactatagacagaacacattttagcaaatgctgctatagt
gcttttttaggaaataaaatatcaggtgttctactttactcttcaagaactgcagaaata
ctaatagaattaataaaaaaatacaatatacaagataaaataagtaacattacagcttac
acaatgagcaataaaattgcaaacaccgcaaaaaatgttcattggaaaacgataaaaata
tctgatcaacctactaatgaatcactactatcattaatttcaaataacattagaaacatt
taa

DBGET integrated database retrieval system