KEGG   Ehrlichia canis: Ecaj_0546Help
Entry
Ecaj_0546         CDS       T00270                                 

Definition
uroporphyrinogen III synthase HEM4 (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ecn  Ehrlichia canis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ecn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
797937..798659
Genome map
AA seq 240 aa AA seqDB search
MQFYYMKSLLVTRPEKDSIKIKESLNKLGFNVYIEPMFSIKYLTAKITLKDFDLIICTSQ
HSIIALSKITKNRDITIITVGNNTMHIAQELGFTFVKSLNGNINDVVSYLQNYSKSNILY
IRGKEVTYNLKKTFNHYKNFQEIILYNTIDRTHFSKCCYSAFLGNKISGVLLYSSRTAEI
LIELIKKYNIQDKISNITAYTMSNKIANTAKNVHWKTIKISDQPTNESLLSLISNNIRNI
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgcaattttattatatgaaatctttattagttactcgtccagaaaaagactctatcaaa
attaaggaatctctcaataaattagggttcaatgtgtatatcgagccaatgttttcaata
aaatatttaacagctaaaataacactaaaagattttgatttgataatatgtacaagtcag
catagcataattgctttaagtaaaatcaccaaaaacagggatataactatcatcacagtc
ggtaataacactatgcacattgcacaagaattagggtttacatttgtaaaatcacttaat
ggcaatattaacgatgttgtttcttatctacaaaattatagcaaatctaatattttatac
ataagagggaaagaagtaacatacaatctcaaaaaaacttttaaccattacaaaaacttt
caagaaattatactatacaatactatagacagaacacattttagcaaatgctgctatagt
gcttttttaggaaataaaatatcaggtgttctactttactcttcaagaactgcagaaata
ctaatagaattaataaaaaaatacaatatacaagataaaataagtaacattacagcttac
acaatgagcaataaaattgcaaacaccgcaaaaaatgttcattggaaaacgataaaaata
tctgatcaacctactaatgaatcactactatcattaatttcaaataacattagaaacatt
taa

DBGET integrated database retrieval system