KEGG   Ehrlichia canis: Ecaj_0659Help
Entry
Ecaj_0659         CDS       T00270                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ecn  Ehrlichia canis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Ecaj_0659
Enzymes [BR:ecn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Ecaj_0659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
928689..929207
Genome map
AA seq 172 aa AA seqDB search
MCGPLSNDIVILALGSNCGNMLGYIKSAVSMLPLYNMNYSYLYKTPALLPENAADHWDTP
FLNMVVSGYTNLSPHSMLEQVKSIEKKLGRISHERWAPRPIDIDIILWENTVLDLDNLSI
PHKQMHCRDFVLVPLCDIYARLPHPTSKTSIQDMLLKLKDINLIKQNANLFE
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtccattgagtaatgatattgttatattagcactaggaagtaattgcggtaac
atgttaggatacattaaatcagcagttagtatgttacctctatacaatatgaattattct
tatctttataaaacaccagctctattgccagaaaatgcagctgaccattgggatactcca
tttttgaatatggtagtatcaggatacacaaatttgtcaccacactctatgttagaacaa
gttaaatctattgaaaaaaagcttggtagaattagtcatgaacgttgggcacctaggcct
atagacattgatattatattatgggagaatacagtattggatttagataatttatccatt
cctcacaagcaaatgcattgtagagattttgtgctagtaccactatgcgatatttatgca
agactccctcacccaacatcaaaaacctcaatacaagatatgttattaaaactaaaagat
atcaatttaataaagcagaatgcaaatttatttgaatag

DBGET integrated database retrieval system