KEGG   Ehrlichia canis: Ecaj_0678Help
Entry
Ecaj_0678         CDS       T00270                                 

Definition
(GenBank) Cytochrome c, class I
  KO
K08738  cytochrome c
Organism
ecn  Ehrlichia canis
Pathway
ecn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ecaj_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AAZ68710
JGI: Eca0678
UniProt: Q3YRE5
Position
956080..956601
Genome map
AA seq 173 aa AA seqDB search
MDGFHLNKIFTAILFSSFIILFISNVVDLLYNPNPHAEQVRGYQINIEEQPVNTAINSTE
TQTDIETLIAQADITKGKEITKKCISCHTFEKGGANRVGPNLWNIIGNKKAHLGDKFNYS
KAMLNKGGTWEHQDLFEFLTKPQAYIKGTRMAFAGISKPQDVADLIAYLKSLN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggacggattccacttaaacaaaatattcacagcaattttgttttcatcttttataata
cttttcattagtaatgtagtagatttactatacaaccccaatccacacgctgaacaggta
agagggtatcaaataaacattgaggaacagccagttaacacagcaattaatagtacagaa
acacaaactgatattgaaactctgatagcacaagcagatattacaaaaggcaaggaaata
acaaaaaaatgcatatcttgtcacacttttgaaaaaggtggagcaaatagagttgggcca
aacttatggaatataataggcaataaaaaagcacatttaggagataaattcaattattca
aaagcaatgctcaataaaggcggcacatgggaacaccaagatttatttgagtttttaaca
aaacctcaagcatacattaaaggtacacgtatggcatttgctggaatatcaaaacctcaa
gatgtagcagatttaattgcatatttaaaatccttaaattag

DBGET integrated database retrieval system