KEGG   Ehrlichia canis: Ecaj_0678Help
Entry
Ecaj_0678         CDS       T00270                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
ecn  Ehrlichia canis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Ecaj_0678
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Ecaj_0678
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
956080..956601
Genome map
AA seq 173 aa AA seqDB search
MDGFHLNKIFTAILFSSFIILFISNVVDLLYNPNPHAEQVRGYQINIEEQPVNTAINSTE
TQTDIETLIAQADITKGKEITKKCISCHTFEKGGANRVGPNLWNIIGNKKAHLGDKFNYS
KAMLNKGGTWEHQDLFEFLTKPQAYIKGTRMAFAGISKPQDVADLIAYLKSLN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggacggattccacttaaacaaaatattcacagcaattttgttttcatcttttataata
cttttcattagtaatgtagtagatttactatacaaccccaatccacacgctgaacaggta
agagggtatcaaataaacattgaggaacagccagttaacacagcaattaatagtacagaa
acacaaactgatattgaaactctgatagcacaagcagatattacaaaaggcaaggaaata
acaaaaaaatgcatatcttgtcacacttttgaaaaaggtggagcaaatagagttgggcca
aacttatggaatataataggcaataaaaaagcacatttaggagataaattcaattattca
aaagcaatgctcaataaaggcggcacatgggaacaccaagatttatttgagtttttaaca
aaacctcaagcatacattaaaggtacacgtatggcatttgctggaatatcaaaacctcaa
gatgtagcagatttaattgcatatttaaaatccttaaattag

DBGET integrated database retrieval system