KEGG   Ehrlichia canis: Ecaj_0857Help
Entry
Ecaj_0857         CDS       T00270                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ecn  Ehrlichia canis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ecn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Ecaj_0857
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ecaj_0857
  Amino acid metabolism
   00310 Lysine degradation
    Ecaj_0857
Enzymes [BR:ecn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Ecaj_0857
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1205663..1206865)
Genome map
AA seq 400 aa AA seqDB search
MSEIQVKAENLGGESILEAPIRVSVNVGDTVKQGDMLFIIETDKTSLEIVSPEDGVIGEI
FVTDEAMIQRGQVLCTINTVQSSAVESSDTSSAHNATTTAADCMQQFIQKKDAPSATKLM
KENSIDRDQISGSGVSGRITKSDVLNYMKSTASEGSNINRLAVVSEGKREDRVKMSKIRQ
VIAARLKESQNTAAILTTFNEVDMKNVMDLRAQYRENFEKKYSIKLGFMSFFIKAVILAL
KELPVINAEISGNEIVYKHYYDIGIAVGTDKGLVVPVIRDADKMSFSELELTLAALGKKA
REGKLEVSDMAGATFTITNGGVYGSLLSTPIINPPQSGILGMHSIQKRPVAVDDKTIEIR
PMMYIALSYDHRIVDGQGAVTFLVRVKQYIEDPSRMFLEV
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagatacaagtaaaggctgaaaatcttggtggtgagtcaatattggaggctcct
attagagtttcagtgaatgttggtgatacggtaaaacaaggtgatatgttgtttatcata
gagactgataagacttcgcttgaaattgtatctcctgaagatggtgttattggtgaaata
tttgttactgatgaagcaatgatacaaagaggacaagtgttgtgtacaataaatactgtg
caatcaagtgctgttgaatcgtctgatacttcttctgcgcataatgctactactacagcg
gctgattgcatgcagcaatttatacagaaaaaagatgcgccatctgcaacgaagctgatg
aaagaaaattcaatagatcgagatcagataagtggttctggtgttagtgggagaattaca
aagtctgatgttttgaattacatgaaatctactgcttctgaaggaagcaatattaatcga
ttggctgttgtttctgaaggaaaaagggaagaccgtgtcaagatgagtaaaattaggcaa
gtaattgctgcaaggttaaaagaatctcaaaatacagctgccatattaactacttttaat
gaagttgatatgaaaaatgttatggatcttagagctcagtatagggaaaattttgagaag
aaatatagtataaagcttggtttcatgtcgttctttataaaagcagtaatattggcatta
aaagagttaccggtaatcaatgctgaaatatcaggtaatgaaattgtgtataagcattat
tatgatataggtattgctgtaggtacagacaaagggttggttgtgccagtaatacgtgat
gctgataaaatgtctttttctgagcttgaattaacgcttgctgctttaggcaagaaagca
agagaagggaagttagaagtttctgatatggcaggtgcaacatttactattaccaatggt
ggtgtctatggttcattgctttctactcctataattaatcctcctcaatctgggatttta
ggtatgcattcaatacagaagcgtcctgttgcagttgatgacaaaactatagaaattaga
ccaatgatgtatattgctctatcttatgatcatcggattgttgatggacaaggtgctgtg
acatttttggtaagagtaaaacaatatattgaagatcctagcagaatgtttttagaagta
taa

DBGET integrated database retrieval system