KEGG   Escherichia coli K-12 MG1655: b3627Help
Entry
b3627             CDS       T00007                                 

Gene name
waaR
Definition
UDP-D-galactose:(glucosyl)lipopolysaccharide-alpha-1,3-D-galactosyltransferase (EC:2.4.1.44)
Orthology
K03275  
UDP-glucose:(glucosyl)LPS alpha-1,3-glucosyltransferase [EC:2.4.1.-]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    b3627 (waaR)
Enzymes [BR:eco01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     b3627 (waaR)
Glycosyltransferases [BR:eco01003]
 Polysaccharide
  Bacterial polysaccharide
   b3627 (waaR)
Lipopolysaccharide biosynthesis proteins [BR:eco01005]
 Core region
  b3627 (waaR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
EcoGene: 
ASAP: 
UniProt: 
Position
complement(3802039..3803058)
Genome map
AA seq 339 aa AA seqDB search
MQQVFFQETEFLNSVIDYDHKVETENLCLDIAYGTDKNFLFGCGISIASILKYNEGSRLC
FHIFTDYFGDDDRKYFDALALQYKTRIKIYLINGDRLRSLPSTKNWTHAIYFRFVIADYF
INKAPKVLYLDADIICQGTIEPLINFSFPDDKVAMVVTEGQADWWEKRAHSLGVAGIAKG
YFNSGFLLINTAQWAAQQVSARAIAMLNEPEIIKKITHPDQDVLNMLLADKLIFADIKYN
TQFSLNYQLKESFINPVTNDTIFIHYIGPTKPWHDWAWDYPVSQAFMEAKNASPWKNTAL
LKPNNSNQLRYSAKHMLKKHRYLKGFSNYLFYFIEKIKH
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaggtgtttttccaggaaactgagtttcttaattcagttattgattatgatcat
aaagtagaaacagaaaatctttgtctggacatcgcttatggaactgacaaaaactttcta
tttggttgcggaatttcgattgcttcaatattaaaatataatgaaggaagtcgattgtgt
ttccatatttttactgattattttggtgatgatgatcgtaagtattttgatgccctggcg
ttgcagtataaaaccagaattaaaatatatctgattaatggtgatcgactgcgctcattg
cctagcactaagaattggactcatgcaatatattttcgttttgttattgcagattacttt
attaataaggcgcctaaagtcctttatctggatgcagatatcatttgtcaggggactatt
gagccactaattaatttctcatttcctgacgataaagtcgcaatggttgttacagaaggg
caagctgactggtgggaaaaacgcgcccattcgttaggtgttgcgggaattgctaaaggt
tactttaactccggttttttattgattaatactgcccaatgggcggctcagcaggtttct
gcacgagctattgcaatgctaaatgagccagaaataatcaaaaaaataacacatcctgat
caggatgtgttaaatatgttgctggcggataaacttattttcgctgatattaaatataac
acccagttcagcttaaattatcaactcaaagaaagctttataaacccagtaaccaacgat
actatttttatccattatatcgggccaaccaagccctggcatgattgggcctgggattat
cctgtatcacaagcctttatggaggcaaaaaatgcttcgccatggaagaatacggcgttg
ctgaaaccgaacaatagcaatcaattaagatatagcgcaaaacatatgcttaaaaagcat
agatatctaaaaggatttagcaactatcttttttattttattgaaaagataaagcattaa

DBGET integrated database retrieval system