KEGG   Escherichia coli K-12 MG1655: b0003Help
Entry
b0003             CDS       T00007                                 

Gene name
thrB
Definition
(RefSeq) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
eco00260  Glycine, serine and threonine metabolism
eco01100  Metabolic pathways
eco01110  Biosynthesis of secondary metabolites
eco01120  Microbial metabolism in diverse environments
eco01230  Biosynthesis of amino acids
Module
eco_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b0003 (thrB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     b0003 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-GeneID: 947498
NCBI-ProteinID: NP_414544
Pasteur: thrB
RegulonDB: ECK120000988
ECOCYC: EG10999
ASAP: ABE-0000010
UniProt: P00547
Position
2801..3733
Genome map
AA seq 310 aa AA seqDB search
MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAETFSLNNLGRFADKLPSEP
RENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVVAALMAMNEHCGKPLND
TRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQQVPGFDEWLWVLAYPGI
KVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELAAKLMKDVIAEPYRERLLP
GFRQARQAVAEIGAVASGISGSGPTLFALCDKPETAQRVADWLGKNYLQNQEGFVHICRL
DTAGARVLEN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagtttatgccccggcttccagtgccaatatgagcgtcgggtttgatgtgctc
ggggcggcggtgacacctgttgatggtgcattgctcggagatgtagtcacggttgaggcg
gcagagacattcagtctcaacaacctcggacgctttgccgataagctgccgtcagaacca
cgggaaaatatcgtttatcagtgctgggagcgtttttgccaggaactgggtaagcaaatt
ccagtggcgatgaccctggaaaagaatatgccgatcggttcgggcttaggctccagtgcc
tgttcggtggtcgcggcgctgatggcgatgaatgaacactgcggcaagccgcttaatgac
actcgtttgctggctttgatgggcgagctggaaggccgtatctccggcagcattcattac
gacaacgtggcaccgtgttttctcggtggtatgcagttgatgatcgaagaaaacgacatc
atcagccagcaagtgccagggtttgatgagtggctgtgggtgctggcgtatccggggatt
aaagtctcgacggcagaagccagggctattttaccggcgcagtatcgccgccaggattgc
attgcgcacgggcgacatctggcaggcttcattcacgcctgctattcccgtcagcctgag
cttgccgcgaagctgatgaaagatgttatcgctgaaccctaccgtgaacggttactgcca
ggcttccggcaggcgcggcaggcggtcgcggaaatcggcgcggtagcgagcggtatctcc
ggctccggcccgaccttgttcgctctgtgtgacaagccggaaaccgcccagcgcgttgcc
gactggttgggtaagaactacctgcaaaatcaggaaggttttgttcatatttgccggctg
gatacggcgggcgcacgagtactggaaaactaa

DBGET integrated database retrieval system