KEGG   Escherichia coli K-12 MG1655: b0003Help
Entry
b0003             CDS       T00007                                 

Gene name
thrB
Definition
(RefSeq) homoserine kinase (EC:2.7.1.39)
  KO
K00872  
homoserine kinase [EC:2.7.1.39]
Organism
eco  Escherichia coli K-12 MG1655
Pathway
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:eco00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    b0003 (thrB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    b0003 (thrB)
Enzymes [BR:eco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     b0003 (thrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
2801..3733
Genome map
AA seq 310 aa AA seqDB search
MVKVYAPASSANMSVGFDVLGAAVTPVDGALLGDVVTVEAAETFSLNNLGRFADKLPSEP
RENIVYQCWERFCQELGKQIPVAMTLEKNMPIGSGLGSSACSVVAALMAMNEHCGKPLND
TRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENDIISQQVPGFDEWLWVLAYPGI
KVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPELAAKLMKDVIAEPYRERLLP
GFRQARQAVAEIGAVASGISGSGPTLFALCDKPETAQRVADWLGKNYLQNQEGFVHICRL
DTAGARVLEN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggttaaagtttatgccccggcttccagtgccaatatgagcgtcgggtttgatgtgctc
ggggcggcggtgacacctgttgatggtgcattgctcggagatgtagtcacggttgaggcg
gcagagacattcagtctcaacaacctcggacgctttgccgataagctgccgtcagaacca
cgggaaaatatcgtttatcagtgctgggagcgtttttgccaggaactgggtaagcaaatt
ccagtggcgatgaccctggaaaagaatatgccgatcggttcgggcttaggctccagtgcc
tgttcggtggtcgcggcgctgatggcgatgaatgaacactgcggcaagccgcttaatgac
actcgtttgctggctttgatgggcgagctggaaggccgtatctccggcagcattcattac
gacaacgtggcaccgtgttttctcggtggtatgcagttgatgatcgaagaaaacgacatc
atcagccagcaagtgccagggtttgatgagtggctgtgggtgctggcgtatccggggatt
aaagtctcgacggcagaagccagggctattttaccggcgcagtatcgccgccaggattgc
attgcgcacgggcgacatctggcaggcttcattcacgcctgctattcccgtcagcctgag
cttgccgcgaagctgatgaaagatgttatcgctgaaccctaccgtgaacggttactgcca
ggcttccggcaggcgcggcaggcggtcgcggaaatcggcgcggtagcgagcggtatctcc
ggctccggcccgaccttgttcgctctgtgtgacaagccggaaaccgcccagcgcgttgcc
gactggttgggtaagaactacctgcaaaatcaggaaggttttgttcatatttgccggctg
gatacggcgggcgcacgagtactggaaaactaa

DBGET integrated database retrieval system