KEGG   Escherichia coli K-12 MG1655: b0010Help
Entry
b0010             CDS       T00007                                 

Gene name
satP
Definition
(RefSeq) succinate-acetate transporter
  KO
K07034  
uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
complement(9928..10494)
Genome map
AA seq 188 aa AA seqDB search
MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFYGGIAQIFAGLLEYKK
GNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLGLWGVFTLFMFFGTLKG
ARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGASAIYLAMGEVLNEQFGRT
VLPIGESH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacactaagttggctaatccggcaccgctgggcctgatgggcttcggcatgacc
accattctgcttaacctgcacaacgtgggttatttcgctctggacggtattattcttgcc
atgggcattttctacggcggcatcgcgcaaatttttgctggtctgctggagtacaaaaaa
ggcaacactttcggtttaaccgcattcacctcttacggttctttctggctgacgctggtt
gcgattctgctgatgccgaaactgggtctgaccgatgcgccaaatgcacagttccttggt
gtctacctgggtctgtggggcgtatttacgctgtttatgttcttcggcacgctgaaaggc
gcacgcgttctgcaattcgttttctttagcctgaccgtgctgtttgccctgctggcgatc
ggtaacattgccggtaacgccgcaatcatccactttgccggctggattgggctgatctgc
ggtgccagcgcaatctatctggcgatgggtgaagtactgaacgagcagtttggtcgcacc
gttctgccgattggtgaatcccactaa

DBGET integrated database retrieval system