KEGG   Escherichia coli K-12 MG1655: b0010Help
Entry
b0010             CDS       T00007                                 

Gene name
satP
Definition
(RefSeq) succinate-acetate transporter
  KO
K07034  uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Grp1_Fun34_YaaH
Motif
Other DBs
NCBI-GeneID: 944792
NCBI-ProteinID: NP_414551
Pasteur: yaaH
RegulonDB: ECK120001468
ECOCYC: EG11512
ASAP: ABE-0000032
UniProt: P0AC98
Position
complement(9928..10494)
Genome map
AA seq 188 aa AA seqDB search
MGNTKLANPAPLGLMGFGMTTILLNLHNVGYFALDGIILAMGIFYGGIAQIFAGLLEYKK
GNTFGLTAFTSYGSFWLTLVAILLMPKLGLTDAPNAQFLGVYLGLWGVFTLFMFFGTLKG
ARVLQFVFFSLTVLFALLAIGNIAGNAAIIHFAGWIGLICGASAIYLAMGEVLNEQFGRT
VLPIGESH
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacactaagttggctaatccggcaccgctgggcctgatgggcttcggcatgacc
accattctgcttaacctgcacaacgtgggttatttcgctctggacggtattattcttgcc
atgggcattttctacggcggcatcgcgcaaatttttgctggtctgctggagtacaaaaaa
ggcaacactttcggtttaaccgcattcacctcttacggttctttctggctgacgctggtt
gcgattctgctgatgccgaaactgggtctgaccgatgcgccaaatgcacagttccttggt
gtctacctgggtctgtggggcgtatttacgctgtttatgttcttcggcacgctgaaaggc
gcacgcgttctgcaattcgttttctttagcctgaccgtgctgtttgccctgctggcgatc
ggtaacattgccggtaacgccgcaatcatccactttgccggctggattgggctgatctgc
ggtgccagcgcaatctatctggcgatgggtgaagtactgaacgagcagtttggtcgcacc
gttctgccgattggtgaatcccactaa

DBGET integrated database retrieval system