KEGG   Escherichia coli K-12 MG1655: b0013Help
Entry
b0013             CDS       T00007                                 

Gene name
yaaI
Definition
(RefSeq) UPF0412 family protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2541
Motif
Other DBs
NCBI-GeneID: 944751
NCBI-ProteinID: NP_414554
Pasteur: yaaI
RegulonDB: ECK120004453
ECOCYC: G8202
ASAP: ABE-0000043
UniProt: P28696
Position
complement(11382..11786)
Genome map
AA seq 134 aa AA seqDB search
MKSVFTISASLAISLMLCCTAQANDHKLLGAIAMPRNETNDLALKLPVCRIVKRIQLSAD
HGDLQLSGASVYFKAARSASQSLNIPSEIKEGQTTDWININSDNDNKRCVSKITFSGHTV
NSSDMATLKIIGDD
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaaatccgtttttacgatttccgccagcctggcgattagcctgatgctgtgctgcacg
gcgcaggcaaacgaccataaactcctcggcgccattgcaatgccgcgtaacgaaaccaac
gatctggcgctgaaacttcctgtttgtcgcattgtgaaacgcatacaactctctgccgac
catggcgatttacagttaagcggtgcatcggtttatttcaaagccgcccgtagcgccagt
cagagcctgaatattccttcagaaataaaagaagggcaaaccactgactggatcaacatt
aacagcgataacgacaataaacgctgcgtctcaaaaatcaccttttcgggtcatacggtg
aactcatcggatatggccacgctgaaaattatcggcgacgactaa

DBGET integrated database retrieval system