KEGG   Escherichia coli K-12 MG1655: b0015Help
Entry
b0015             CDS       T00007                                 

Gene name
dnaJ
Definition
(RefSeq) chaperone Hsp40, DnaK co-chaperone
  KO
K03686  
molecular chaperone DnaJ
Organism
eco  Escherichia coli K-12 MG1655
Brite
Chaperones and folding catalysts [BR:eco03110]
 Heat shock proteins
  HSP40 / DNAJ
   b0015 (dnaJ)
Mitochondrial biogenesis [BR:eco03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    b0015 (dnaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Structure
PDB: 

Jmol
Position
14168..15298
Genome map
AA seq 376 aa AA seqDB search
MAKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDS
QKRAAYDQYGHAAFEQGGMGGGGFGGGADFSDIFGDVFGDIFGGGRGRQRAARGADLRYN
MELTLEEAVRGVTKEIRIPTLEECDVCHGSGAKPGTQPQTCPTCHGSGQVQMRQGFFAVQ
QTCPHCQGRGTLIKDPCNKCHGHGRVERSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAP
AGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVKLKVPGETQTG
KLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLNERQKQLLQELQESFGGPTGEHNSPRS
KSFFDGVKKFFDDLTR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggctaagcaagattattacgagattttaggcgtttccaaaacagcggaagagcgtgaa
atcagaaaggcctacaaacgcctggccatgaaataccacccggaccgtaaccagggtgac
aaagaggccgaggcgaaatttaaagagatcaaggaagcttatgaagttctgaccgactcg
caaaaacgtgcggcatacgatcagtatggtcatgctgcgtttgagcaaggtggcatgggc
ggcggcggttttggcggcggcgcagacttcagcgatatttttggtgacgttttcggcgat
atttttggcggcggacgtggtcgtcaacgtgcggcgcgcggtgctgatttacgctataac
atggagctcaccctcgaagaagctgtacgtggcgtgaccaaagagatccgcattccgact
ctggaagagtgtgacgtttgccacggtagcggtgcaaaaccaggtacacagccgcagact
tgtccgacctgtcatggttctggtcaggtgcagatgcgccagggattcttcgctgtacag
cagacctgtccacactgtcagggccgcggtacgctgatcaaagatccgtgcaacaaatgt
catggtcatggtcgtgttgagcgcagcaaaacgctgtccgttaaaatcccggcaggggtg
gacactggagaccgcatccgtcttgcgggcgaaggtgaagcgggcgagcatggcgcaccg
gcaggcgatctgtacgttcaggttcaggttaaacagcacccgattttcgagcgtgaaggc
aacaacctgtattgcgaagtcccgatcaacttcgctatggcggcgctgggtggcgaaatc
gaagtaccgacccttgatggtcgcgtcaaactgaaagtgcctggcgaaacccagaccggt
aagctattccgtatgcgcggtaaaggcgtcaagtctgtccgcggtggcgcacagggtgat
ttgctgtgccgcgttgtcgtcgaaacaccggtaggcctgaacgaaaggcagaaacagctg
ctgcaagagctgcaagaaagcttcggtggcccaaccggcgagcacaacagcccgcgctca
aagagcttctttgatggtgtgaagaagttttttgacgacctgacccgctaa

DBGET integrated database retrieval system