KEGG   Escherichia coli K-12 MG1655: b0019Help
Entry
b0019             CDS       T00007                                 

Gene name
nhaA
Definition
(RefSeq) sodium-proton antiporter
  KO
K03313  Na+:H+ antiporter, NhaA family
Organism
eco  Escherichia coli K-12 MG1655
Brite
Transporters [BR:eco02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   b0019 (nhaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_antiport_1
Motif
Other DBs
NCBI-GeneID: 944758
NCBI-ProteinID: NP_414560
Pasteur: nhaA
RegulonDB: ECK120000645
ECOCYC: EG10652
ASAP: ABE-0000068
UniProt: P13738
Structure
PDB: 

Jmol
Position
17489..18655
Genome map
AA seq 388 aa AA seqDB search
MKHLHRFFSSDASGGIILIIAAILAMIMANSGATSGWYHDFLETPVQLRVGSLEINKNML
LWINDALMAVFFLLVGLEVKRELMQGSLASLRQAAFPVIAAIGGMIVPALLYLAFNYADP
ITREGWAIPAATDIAFALGVLALLGSRVPLALKIFLMALAIIDDLGAIIIIALFYTNDLS
MASLGVAAVAIAVLAVLNLCGARRTGVYILVGVVLWTAVLKSGVHATLAGVIVGFFIPLK
EKHGRSPAKRLEHVLHPWVAYLILPLFAFANAGVSLQGVTLDGLTSILPLGIIAGLLIGK
PLGISLFCWLALRLKLAHLPEGTTYQQIMVVGILCGIGFTMSIFIASLAFGSVDPELINW
AKLGILVGSISSAVIGYSWLRVRLRPSV
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatctgcatcgattctttagcagtgatgcctcgggaggcattattcttatcatt
gccgctatcctggcgatgattatggccaacagcggcgcaaccagtggatggtatcacgac
tttctggagacgccggttcagctccgggttggttcactcgaaatcaacaaaaacatgctg
ttatggataaatgacgcgctgatggcggtatttttcctgttagtcggtctggaagttaaa
cgtgaactgatgcaaggatcgctagccagcttacgccaggccgcatttccagttatcgcc
gctattggtgggatgattgtgccggcattactctatctggcttttaactatgccgatccg
attacccgcgaagggtgggcgatcccggcggctactgacattgcttttgcacttggtgta
ctggcgctgttgggaagtcgtgttccgttagcgctgaagatctttttgatggctctggct
attatcgacgatcttggggccatcattatcatcgcattgttctacactaatgacttatcg
atggcctctcttggcgtcgcggctgtagcaattgcggtactcgcggtattgaatctgtgt
ggtgcacgccgcacgggcgtctatattcttgttggcgtggtgttgtggactgcggtgttg
aaatcgggggttcacgcaactctggcgggggtaattgtcggcttctttattcctttgaaa
gagaagcatgggcgttctccagcgaagcgactggagcatgtgttgcacccgtgggtggcg
tatctgattttgccgctgtttgcatttgctaatgctggcgtttcactgcaaggcgtcacg
ctggatggcttgacctccattctgccattggggatcatcgctggcttgctgattggcaaa
ccgctggggattagtctgttctgctggttggcgctgcgtttgaaactggcgcatctgcct
gagggaacgacttatcagcaaattatggtggtggggatcctgtgcggtatcggttttact
atgtctatctttattgccagcctggcctttggtagcgtagatccagaactgattaactgg
gcgaaactcggtatcctggtcggttctatctcttcggcggtaattggatacagctggtta
cgcgttcgtttgcgtccatcagtttga

DBGET integrated database retrieval system