KEGG   Escherichia coli K-12 MG1655: b0024Help
Entry
b0024             CDS       T00007                                 

Gene name
yaaY
Definition
(RefSeq) uncharacterized protein
Organism
eco  Escherichia coli K-12 MG1655
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
RegulonDB: 
EcoGene: 
ECOCYC: 
ASAP: 
UniProt: 
Position
21181..21399
Genome map
AA seq 72 aa AA seqDB search
MCRHSLRSDGAGFYQLAGCEYSFSAIKIAAGGQFLPVICAMAMKSHFFLISVLNRRLTLT
AVQGILGRFSLF
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtgccggcactcgttacgtagtgatggcgcaggattctaccagcttgcggggtgtgaa
tacagcttttccgcgataaaaattgcagcaggcggtcagtttcttcccgtgatttgcgcc
atggcaatgaaaagccacttctttctgatttcggtactcaatcgccggttaaccttgacc
gctgtacaaggtatactcggacgattttcactgttttga

DBGET integrated database retrieval system